ADWX-1

• Description:

  ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent) . ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways

• Specifications:

  Kv1.3 channel blocker

• Target:

  K channels

• Sequence:

  VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK

• Peptide Number:

  13ADW001

• Disulfide Bonds:

  Cys7-Cys27; Cys13-Cys32; Cys17-Cys34

• N Terminal Sequence:

  H

• C Terminal Sequence:

  OH