Recombinant Human Kit ligand (KITLG), partial (Active)

CAT: 0013-GTR19064060-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19064060-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Human Kit ligand (KITLG), partial (Active) spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Name Alternative

Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand

UniProt

P21583

Expression Region

26-189aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

UniProtKB · P21583

Kit ligand

SCF_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P21583
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: KITLG
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A0AV09, A8K2Q4, B7ZLM4, Q16487, Q68DZ2, Q7M4N8, Q9UQK7

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

Disease

DeafnessDisease variantNon-syndromic deafnessWaardenburg syndrome

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19122925-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
GTR19149251-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
GTR19025306-01	Recombinant Human Kit ligand protein (KITLG) (Active)
GTR19027638-01	Recombinant Human Kit ligand (KITLG), partial
GTR19025305-01	Recombinant Mouse Kit ligand protein (Kitlg) (Active)
GTR19069554-01	Recombinant Human Kit ligand (KITLG), partial
GTR19122432-01	Recombinant Mouse Kit ligand (Kitlg), partial
GTR19065338-01	Recombinant Bovine Kit ligand (KITLG), partial
GTR19078371-01	Recombinant Mouse Kit ligand (Kitlg)
GTR19078366-01	Recombinant Cat Kit ligand (KITLG)

Alternative Products

Catalog	Name
MBS9021264-01	Recombinant Human Kit ligand (KITLG), partial (Active)
CSB-MP012376MO1d9-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
RPC29296-01	Recombinant Human Kit ligand (KITLG), partial , Active Protein
RPC29174-01	Recombinant Mouse Kit ligand (Kitlg), partial , Active Protein
CSB-AP002061HU-01	Recombinant Human Kit ligand protein (KITLG), partial (Active)
CSB-AP003151MO-01	Recombinant Mouse Kit ligand protein (Kitlg), partial (Active)
RPC28991-01	Recombinant Mouse Kit ligand protein (Kitlg), partial , Active Protein
RPC28990-01	Recombinant Human Kit ligand protein (KITLG), partial , Active Protein
348158	Kit Ligand, active (KITLG), Recombinant, Human
348159	Kit Ligand, active (Kitlg), Recombinant, Mouse