Recombinant Mouse Kit ligand (Kitlg), partial (Active)

CAT: 0399-CSB-MP012376MO1d9-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-MP012376MO1d9-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; c-Kit ligand [Cleaved into: Soluble KIT ligand; sKITLG]

Abbreviation

Recombinant Mouse Kitlg protein, partial (Active)

Gene Name

Kitlg

UniProt

P20826

Expression Region

26-189aa

Organism

Mus musculus (Mouse)

Target Sequence

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

1Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit (CSB-MP012375MO1) at 2 μg/mL can bind Mouse Kitlg. The EC50 is 19.35-24.80 ng/mL. 2Recombinant Mouse Kitlg captured on Protein A Chip can bind Recombinant Mouse Kit (CSB-MP012375MO1) with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200) .

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.2 kDa

References & Citations

The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

UniProtKB · P20826

Kit ligand

SCF_MOUSE · Mus musculus

View on UniProt ↗

Primary accession: P20826
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Kitlg
Protein existence: 1: Evidence at protein level
Organism: Mus musculus (Mouse)
Taxonomy ID: 10090
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: P97332, Q3TNJ7, Q62524, Q64222, Q921N5

Protein keywords

Technical term

3D-structureDirect protein sequencingReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
CSB-MP002061HU1-01	Recombinant Human Kit ligand (KITLG), partial (Active)
CSB-AP003881HU-01	Recombinant Human Kit ligand (KITLG), partial (Active)
CSB-AP003741HU-01	Recombinant Human Kit ligand (KITLG), partial (Active)
CSB-MP002061HU-WD-01	Recombinant Human Kit ligand (KITLG), partial (Active)
CSB-AP003151MO-01	Recombinant Mouse Kit ligand protein (Kitlg), partial (Active)
CSB-AP002061HU-01	Recombinant Human Kit ligand protein (KITLG), partial (Active)
CSB-YP012376MO1-01	Recombinant Mouse Kit ligand (Kitlg), partial
CSB-EP012376HU-01	Recombinant Human Kit ligand (KITLG), partial
CSB-MP002061HU1h6-01	Recombinant Human Kit ligand (KITLG), partial
CSB-EP012376BO-01	Recombinant Bovine Kit ligand (KITLG), partial

Alternative Products

Catalog	Name
MBS9021264-01	Recombinant Human Kit ligand (KITLG), partial (Active)
GTR19122925-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
RPC29160-01	Recombinant Human Kit ligand (KITLG), partial , Active Protein
RPC29174-01	Recombinant Mouse Kit ligand (Kitlg), partial , Active Protein
RPC28991-01	Recombinant Mouse Kit ligand protein (Kitlg), partial , Active Protein
RPC28990-01	Recombinant Human Kit ligand protein (KITLG), partial , Active Protein
348158	Kit Ligand, active (KITLG), Recombinant, Human
348159	Kit Ligand, active (Kitlg), Recombinant, Mouse
AP73590	Recombinant Human Kit ligand protein (KITLG) (Active)
GTR19025305-01	Recombinant Mouse Kit ligand protein (Kitlg) (Active)