Recombinant Human Kit ligand (KITLG), partial

CAT: 0013-GTR19069554-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19069554-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This product is C-terminal hFc-Myc-tagged. It spans the sequence region 26-189aa.

Product Name Alternative

Kit ligand (Mast cell growth factor) (Stem cell factor) (c-Kit ligand) (MGF) (SCF)

UniProt

P21583

Expression Region

26-189aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

UniProtKB · P21583

Kit ligand

SCF_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P21583
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: KITLG
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A0AV09, A8K2Q4, B7ZLM4, Q16487, Q68DZ2, Q7M4N8, Q9UQK7

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

Disease

DeafnessDisease variantNon-syndromic deafnessWaardenburg syndrome

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19122432-01	Recombinant Mouse Kit ligand (Kitlg), partial
GTR19065338-01	Recombinant Bovine Kit ligand (KITLG), partial
GTR19122925-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
GTR19149251-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
GTR19078371-01	Recombinant Mouse Kit ligand (Kitlg)
GTR19078366-01	Recombinant Cat Kit ligand (KITLG)
GTR19078384-01	Recombinant Sheep Kit ligand (KITLG)
GTR19078372-01	Recombinant Rat Kit ligand (Kitlg)
GTR19025306-01	Recombinant Human Kit ligand protein (KITLG) (Active)
GTR18799809	Human SCF/KITLG/Kit ligand ELISA Kit

Alternative Products

Catalog	Name
MBS7135739-01	Recombinant Human Kit ligand (KITLG), partial
AP70472-01	Recombinant Human Kit ligand(KITLG), partial
MBS9021264-01	Recombinant Human Kit ligand (KITLG), partial (Active)
MBS1381870-01	Recombinant Goat Kit ligand (KITLG), partial
MBS1348682-01	Recombinant Pig Kit ligand (KITLG), partial
MBS7111953	Recombinant Cat Kit ligand (KITLG), partial
CSB-YP012376MO1-01	Recombinant Mouse Kit ligand (Kitlg), partial
MBS1376985-01	Recombinant Horse Kit ligand (KITLG), partial
MBS1355066-01	Recombinant Chicken Kit ligand (KITLG), partial
MBS7111955	Recombinant Rat Kit ligand (Kitlg), partial