Products for Research Use Only

RecombinantEGF, Rat (CHO-expressed)

CAT: 0013-GTR18990438-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990438-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.
Product Name Alternative
Epidermal Growth Factor
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
~6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR