RecombinantEGF, Rat (CHO-expressed)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantEGF, Rat (CHO-expressed)
Description:
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.Endotoxin:
< 0.2 EU/μg, determined by LAL method.Purity:
> 95% as analyzed by SDS-PAGE and HPLC.Bioactivity:
ED50 < 0.1 ng/ml, measured in a cell proliferation assay using 3T3 cells.Reconstitution:
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight:
~6 kDa, observed by reducing SDS-PAGE.Storage Conditions:
Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation:
Lyophilized after extensive dialysis against PBS.Host or Source:
CHORecommended Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number:
9000-83-3AA Sequence:
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
