Products for Research Use Only

RecombinantEGF, Rat (CHO-expressed)

CAT: 0384-BK0196-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0196-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
~6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Popular Products