Products for Research Use Only
RegisterLogin

Exodus-2/CCL21, Human

CAT: 0804-HY-P7166-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7166-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Exodus-2/CCL21 Protein, Human is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Human is a recombinant human Exodus-2/CCL21 (S24-P134) expressed by E. coli[1].
Product Name Alternative
Exodus-2/CCL21 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/exodus-2-ccl21-protein-human.html
Purity
97.00
Smiles
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Molecular Formula
6366 (Gene_ID) O00585 (S24-P134) (Accession)
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Manzo A, et al. CCL21 expression pattern of human secondary lymphoid organ stroma is conserved in inflammatory lesions with lymphoid neogenesis. Am J Pathol. 2007 Nov;171 (5) :1549-62.|[2]Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel) . 2020 Apr 23;12 (4) :1036.|[3]Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30 (9) :1864-73.|[4]Marieke Bax, et al. Interaction of polysialic acid with CCL21 regulates the migratory capacity of human dendritic cells. PLoS One. 2009 Sep 14;4 (9) :e6987.|[5]Pang MF, et al. TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis. Oncogene. 2016 Feb 11;35 (6) :748-60.|[6]Mo M, et al. CCL21/CCR7 enhances the proliferation, migration, and invasion of human bladder cancer T24 cells. PLoS One. 2015 Mar 23;10 (3) :e0119506.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-174761Human CCL21 mRNA
HY-RS02091CCL21 Human Pre-designed siRNA Set A
HY-P83030-01CCL21 Antibody (YA2775, Rabbit)
HY-P761946Ckine/CCL21, Rhesus Macaque (sf9)
HY-RS23188Ccl21 Rat Pre-designed siRNA Set A
HY-P7161-01CCL24/Eotaxin-2, Human
HY-P7766-01CCL24/Eotaxin-2, Human (HEK293, His)
HY-P700009-01CCL24/Eotaxin-2, Rat
HY-P7760-01CCL24/Eotaxin-2, Mouse
HY-P7162Eotaxin-2/CCL24, Rat

Alternative Products

CatalogName
RC315-32Exodus-2, CCL21, human
Z02843-1Exodus-2/CCL21, Human
MBS691827-01Human Exodus-2 (CCL21)
PT_40105-01Exodus-2 Human Recombinant (CCL21) (Exodus 2 Human)
JOT-PR1024Recombinant Human Exodus-2/CCL21 (rHuExodus-2/CCL21)
GTR18991611-01Recombinant Human Exodus-2/CCL21 (rHuExodus-2/CCL21)
P6654-100μgRecombinant Human Exodus-2/CCL21
MBS567209-01Exodus-2 (CCL21) (human), (recombinant)
7-01840Recombinant Human Exodus-2 (CCL21)
22060318-1Human Exodus-2 (CCL21), Recombinant

Popular Products