MDM2, Human

• Description :

  MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  MDM2 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/mdm2-protein-human.html

• Purity :

  98.0

• Smiles :

  SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

• Molecular Formula :

  4193 (Gene_ID) Q00987 (S17-N111) (Accession)

• Molecular Weight :

  Approximately 11.1-12 KDa

• Shipping Conditions :

  Dry ice

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins