ELA-32(human) (TFA)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS5764091-01	ELA-32 (human)
MBS5764091-02	ELA-32 (human)
TP2097-1g	ELA-32(human)
TP2097-50mg	ELA-32(human)
TP2097-1mg	ELA-32(human)
TP2097-5mg	ELA-32(human)
007-25	ELA-32 (Human)
TP2097-10mg	ELA-32(human)
007-19	[pGlu1]-ELA-32 (Human)
007-30	ELA (19-32) / prepro-ELA (41-54) (Human)

ELA-32(human) (TFA)

CAT:

804-HY-P2196A-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

ELA-32(human) (TFA)

UNSPSC Description: ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
Target Antigen: Apelin Receptor (APJ)
Type: Peptides
Related Pathways: GPCR/G Protein
Field of Research: Cancer
Assay Protocol: https://www.medchemexpress.com/ela-32-human-tfa.html
Purity: 99.27
Solubility: H2O : 100 mg/mL (ultrasonic)
Smiles: [QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) (TFA salt)]
Molecular Weight: 3967.82 (free acid)
Shipping Conditions: Blue Ice
Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)
Clinical Information: No Development Reported

Complementary Product Range

Our range of products, including ELA-32(human) (TFA), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
HY-P2196A-01	ELA-32(human) (TFA)
HY-P2196A-03	ELA-32(human) (TFA)
HY-P2196A-02	ELA-32(human) (TFA)
HY-P2196-03	ELA-32(human)
HY-P2196-02	ELA-32(human)
HY-P2196-01	ELA-32(human)
HY-P2197A-03	ELA-11(human) (TFA)
HY-P2197A-02	ELA-11(human) (TFA)
HY-P2197A-01	ELA-11(human) (TFA)
HY-P2106A-01	Elabela(19-32) (TFA)