GMF-beta, Mouse

• Description :

  GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  GMF-beta Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/gmf-beta-protein-mouse.html

• Purity :

  99.00

• Smiles :

  SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

• Molecular Formula :

  63985 (Gene_ID) Q9CQI3 (S2-H142) (Accession)

• Molecular Weight :

  Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins