R-Spondin-1 Recombinant Protein

R-Spondin-1 Recombinant Protein

• Description: R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant human R-Spondin-1 is a 26.7 kDa protein consisting of 243 amino acid residues.  Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS PAGE analysis under reducing conditions.
• Synonyms: Roof plate-specific Spondin, Rspo1
• CAS Number: 9000-83-3
• NCBI Gene ID: 284654
• UniProt: Q2MKA7
• Accession Number: NP_001033722.1
• Accession Number mRNA: NM_001038633.3
• Host: CHO
• Origin Species: Human
• Species Reactivity: Human
• Sequence: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
• Detection Range: R-spondin-1 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.0-3.0 ug/ml.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 95% by SDS-PAGE & HPLC analyses
• Length: 243
• Form: Lyophilized
• Molecular Weight: 26.7 kDa
• Shipping Conditions: Room Temperature