PDGF-BB

• Description :

  PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two B chains (218 total amino acids) .

• Synonyms :

  PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis; INN=Becaplermin

• NCBI Gene ID :

  5155

• UniProt :

  P01127

• Accession Number :

  NP_002599.1

• Accession Number mRNA :

  NM_002608.2

• Reactivity :

  Human

• Cross Reactivity :

  Human

• Sequence :

  SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

• Assay Protocol :

  Centrifuge vial prior to opening. The lyophilized PDGF-BB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.

• Endotoxin :

  < 0.1 ng per ug of PDGF-BB

• Purity :

  > 95% by SDS-PAGE

• Bioactivity :

  The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts) .

• Length :

  109

• Form :

  Lyophilized

• Buffer :

  50mM acetic acid

• Reconstitution :

  50mM acetic acid

• Molecular Weight :

  24.3 kDa

• Storage Conditions :

  The lyophilized PDGF-BB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-BB is best stored at -20°C to -70°C.

• Host or Source :

  E. coli

• N Terminal Sequence :

  SLGSL