Leptin binding protein Recombinant Protein

CAT:

209-500-046

Size:

100 µg

Price:

Ask

For price, please contact [email protected]

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Leptin binding protein Recombinant Protein

Description: Recombinant human leptin binding domain (hLBD), is one polypeptide chain containing 208 amino acids and an additional Ala at N-terminus acids. It consists of the cytokine binding domain of leptin receptor (amino acids 428-635 of human leptin receptor and having a molecular mass of ~ 24.5 kDa, It was purified by proprietary chromatographic techniques (see Sandowski et al. J. Biol. Chem. (2002) 277(48):46304-9.
Synonyms: Lep; ob; obese
CAS Number: 9000-83-3
NCBI Gene ID: 3953
UniProt: P48357
Accession Number: NP_001003679.1
Accession Number mRNA: NM_001003679.3
Host: E. coli
Origin Species: Human
Species Reactivity: Human
Sequence: AIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMD
Detection Range: Recombinant human LBDL is fully biologically active as evidenced by high affinity binding of mammalian leptins at 1:1 molar ratio.
Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length: 208
Form: Lyophilized
Reconstitution: It is recommended to reconstitute the lyophilized hLBD in sterile water adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Molecular Weight: 24.5 kDa
Shipping Conditions: Room Temperature

Related Products

Cat	Name
500-059	Leptin binding protein Recombinant Protein
500-046S	Leptin binding protein Recombinant Protein
500-059S	Leptin binding protein Recombinant Protein
500-046	Leptin binding protein Recombinant Protein
500-073	Leptin Recombinant Protein
M10-028	Leptin Recombinant Protein
500-061S	Leptin Recombinant Protein
500-072S	Leptin Recombinant Protein
100-061	Leptin Recombinant Protein
R20-033S	Leptin Recombinant Protein

Alternative Products

Cat	Name
abx262059-5ug	Leptin Binding Domain Protein
abx262060-5ug	Leptin Binding Domain Protein
abx262059-1mg	Leptin Binding Domain Protein
abx262059-20ug	Leptin Binding Domain Protein
abx262060-20ug	Leptin Binding Domain Protein
MBS400041-03	Human leptin binding domain
MBS400042-02	Chicken leptin binding domain
MBS400042-01	Chicken leptin binding domain
MBS400041-05	Human leptin binding domain
MBS400042-05	Chicken leptin binding domain