Leptin binding protein Recombinant Protein

Leptin binding protein Recombinant Protein

• Description: Recombinant human leptin binding domain (hLBD), is one polypeptide chain containing 208 amino acids and an additional Ala at N-terminus acids. It consists of the cytokine binding domain of leptin receptor (amino acids 428-635 of human leptin receptor and having a molecular mass of ~ 24.5 kDa, It was purified by proprietary chromatographic techniques (see Sandowski et al. J. Biol. Chem. (2002) 277(48):46304-9.
• Synonyms: Lep; ob; obese
• CAS Number: 9000-83-3
• NCBI Gene ID: 3953
• UniProt: P48357
• Accession Number: NP_001003679.1
• Accession Number mRNA: NM_001003679.3
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: AIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMD
• Detection Range: Recombinant human LBDL is fully biologically active as evidenced by high affinity binding of mammalian leptins at 1:1 molar ratio.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 208
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized hLBD in sterile water adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
• Molecular Weight: 24.5 kDa
• Shipping Conditions: Room Temperature