Leptin Recombinant Protein
CAT:
209-500-058S
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Leptin Recombinant Protein
- Description: Recombinant chicken leptin is an one polypeptide chain containing 145 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Chicken leptin was prepared according to the sequence published by the groups of Taouis and McMutry, purified by proprietary chromatographic techniques, see Raver et al. Protein Expr Purif. 1998 Dec; 14(3):403-8.
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 373955
- UniProt: O42164
- Accession Number: APC23099.1
- Accession Number mRNA: KT970642.1
- Host: E. coli
- Origin Species: Chicken
- Species Reactivity: Chicken
- Sequence: AVPCQIFQDDTKTLIKTIVTRINDISHTSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDISPEC
- Detection Range: Recombinant chicken leptin is biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its activity is however 5-10 fold lower as compared to mammalian leptins.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant chicken leptin in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
- Molecular Weight: 16.0 kDa
- Shipping Conditions: Room Temperature