Leptin N82K mutant, pegylated Recombinant Protein
CAT:
209-500-040
Size:
500 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Leptin N82K mutant, pegylated Recombinant Protein
- Description: Mono-pegylated (with 20 kDa PEG) recombinant human leptin N82K mutant is an one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant human pegylated leptin runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Recombinant human pegylated leptin N82K mutant's half-life in circulation after SC injection was over 20 hours. Recombinant human leptin N82K mutant was purified by proprietary chromatographic techniques according to Salomon et al (2006) Protein Expression and Purification 47, 128–136 and then pegylated.
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 3952
- UniProt: P41159
- Accession Number: NP_000221.1
- Accession Number mRNA: NM_000230
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Tag: PEG
- Sequence: AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEKLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Detection Range: Recombinant pegylated human leptin N82K mutant is less than 0.1% active active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. This abolishment of activity results from drastically reduced affinity toward leptin receptor.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 99.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant human pegylated leptin N82K mutant in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
- Molecular Weight: 35.6 kDa
- Shipping Conditions: Room Temperature