Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
CAT:
209-500-048
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
- Description: Recombinant mouse leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, recombinant mouse leptin was mutated, resulting in L39A/D40A/F41A antagonist that was purified by proprietary chromatographic techniques. according to Salomon et al (2006) Protein Expression and PuriWcation 47, 128–136.
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 16846
- UniProt: P41160
- Accession Number: NP_032519.1
- Accession Number mRNA: NM_008493.3
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
- Detection Range: Recombinant mouse leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant mouse leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
- Molecular Weight: 16.0 kDa
- Shipping Conditions: Room Temperature