Leptin N82K mutant Recombinant Protein

Leptin N82K mutant Recombinant Protein

• Description: Recombinant protein - human leptin N82K mutant was produced by site specific mutagenesis. It consists of one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa., Human leptin mutant was purified by proprietary chromatographic techniques, see Niv-Spector et al. (2010) Mol Genet Metab. 100(2):193-7. It is devoid of biological activity and mey serve for control experiments.
• Synonyms: Lep; ob; obese
• CAS Number: 9000-83-3
• NCBI Gene ID: 3952
• UniProt: P41159
• Accession Number: NP_000221.1
• Accession Number mRNA: NM_000230
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEKLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
• Detection Range: Recombinant human leptin N82K mutant is less than 0.1% active active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. This abolishment of activity results from drastically reduced affinity toward leptin receptor.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 146
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized recombinant human leptin N82K mutant in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Molecular Weight: 16.0 kDa
• Shipping Conditions: Room Temperature