Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
CAT:
209-500-065
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Leptin antagonist (mutant L39A/D40A/F41A) Recombinant Protein
- Description: Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, oLEP was mutated, resulting in L39A/D40A/F41A mutant was purified by proprietary chromatographic techniques. Preparation of recombinant leptin antagonists was recently published - Niv-Spector et al, Biochem. J 291;221-230 (2005).
- Synonyms: Lep; ob; obese
- CAS Number: 9000-83-3
- NCBI Gene ID: 443534
- Accession Number: XP_027824581.2
- Accession Number mRNA: XM_027968780.2
- Host: E. coli
- Origin Species: Ovine
- Species Reactivity: Ovine
- Sequence: AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Detection Range: Ovine recombinant leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of ovine leptin receptor. It also inhibits various leptin effects in several in vitro bioassays.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 146
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized recombinant leptin antagonist in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
- Molecular Weight: 16.0 kDa
- Shipping Conditions: Room Temperature