FGF-4 Recombinant Protein
CAT:
209-300-130
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

FGF-4 Recombinant Protein
- Description: FGF-4 (fibroblast growth factor 4), also known as K-FGF (Kaposi’s sarcoma associated FGF), is a 25 kDa secreted, heparin binding member of the FGF family. The human FGF-4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C terminus. Mature human FGF-4 shares a high aa identity with mouse, rat, canine and bovine FGF-4, respectively. The expression of FGF-4 and its receptors, FGF-R1c, -R2c, -R3c and R4, is spatially and temporally regulated during embryonic development. Its expression in the mouse trophoblast inner cell mass promotes expression of FGF-R2, and is required for maintenance of the trophectoderm and primitive endoderm. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in-vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in-vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in-vivo and has been investigated as therapy for coronary artery disease.
- Synonyms: FGF4; HST; KFGF; HST-1; HSTF1; K-FGF; HBGF-4
- CAS Number: 9000-83-3
- NCBI Gene ID: 2249
- UniProt: P08620
- Accession Number: NP_001998.1
- Accession Number mRNA: NM_002007
- Gene Location: 11q13.3
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Mouse, Rat, Human, Pig
- Sequence: APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLP RL
- Detection Range: The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
- Purity: > 95% by SDS-PAGE
- Length: 177
- Form: Lyophilized
- Buffer: PBS
- Reconstitution: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
- Molecular Weight: 19.7 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted FGF-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.