Complement C5a, Mouse

• Description :

  Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a) . C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].

• Product Name Alternative :

  Complement C5a Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-mouse.html

• Purity :

  98.00

• Smiles :

  NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

• Molecular Formula :

  15139 (Gene_ID) P06684 (N679-R755) (Accession)

• Molecular Weight :

  Approximately 9 kDa

• References & Citations :

  [1]Helga D Manthey, et al. Complement component 5a (C5a) . Int J Biochem Cell Biol. 2009 Nov;41 (11) :2114-7.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins