Complement C5a, Cynomolgus

• Description :

  Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  Complement C5a Protein, Cynomolgus, Cynomolgus, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-cynomolgus.html

• Purity :

  98.00

• Smiles :

  MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR

• Molecular Formula :

  102125658 (Gene_ID) XP_015292262.1 (M678-R751) (Accession)

• Molecular Weight :

  Approximately 11 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins