Complement C5a, Mouse

CAT:
804-HY-P7695-02
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Complement C5a, Mouse - image 1

Complement C5a, Mouse

  • Description :

    Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a) . C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].
  • Product Name Alternative :

    Complement C5a Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-mouse.html
  • Purity :

    98.00
  • Smiles :

    NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
  • Molecular Formula :

    15139 (Gene_ID) P06684 (N679-R755) (Accession)
  • Molecular Weight :

    Approximately 9 kDa
  • References & Citations :

    [1]Helga D Manthey, et al. Complement component 5a (C5a) . Int J Biochem Cell Biol. 2009 Nov;41 (11) :2114-7.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide