Complement C8G, Human (His, solution)

• Description :

  C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His, solution) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  Complement C8G Protein, Human (His, solution), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/complement-c8g-protein-human-his.html

• Purity :

  98.0

• Smiles :

  QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

• Molecular Formula :

  733 (Gene_ID) AAI13627.1 (Q21-R202) (Accession)

• Molecular Weight :

  Approximately 22.0-23.0 kDa

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins