APOC2, Human (His, solution)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


APOC2, Human (His, solution)
Description:
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].Product Name Alternative:
APOC2 Protein, Human (His, solution), Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/apolipoprotein-c-ii-protein-human-his.htmlPurity:
98.0Smiles:
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHHMolecular Formula:
344 (Gene_ID) P02655 (T23-E101) (Accession)Molecular Weight:
Approximately 14 kDaReferences & Citations:
Escherichia coliShipping Conditions:
Dry ice.Storage Conditions:
Stored at -80°C for 1 yearScientific Category:
Recombinant Proteins
