-
Category
Antibody
-
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
Form
Antigen affinity purified
-
Conjugation
Unconjugated
-
Clone
Polyclonal antibody
-
Recognised antigen
Flt3 ligand
-
Host animal
Rabbit (Oryctolagus cuniculus)
-
Clonality
Polyclonal (rabbit origin)
-
Species reactivity
Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applications
WB
-
Recommended dilutions
Western blot: 0.1-0.5ug/ml
-
Notes
Optimal dilution of the Flt3 ligand antibody should be determined by the researcher.
-
Intented use
This Flt3 ligand antibodyis to be used only for research purposes and not for diagnostics..
-
Uniprot
P49771
-
Purity
Antigen affinity
-
Description
FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.
-
Immunogen
Amino acids AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK of human Flt3 ligand were used as the immunogen for the Flt3 ligand antibody.
-
Storage
After reconstitution, the Flt3 ligand antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional description
FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
-
French translation
anticorps
