Flt3 Ligand antibody
-
Catalog number70R-7181
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCytokines & Growth Factors
-
Type of ImmunogenFlt3 Ligand antibodies were raised using the N terminal of FLT3LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY
-
Raised inRabbit
-
SpecificityFlt3 Ligand antibody was raised against the N terminal of FLT3LG
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLT3LG antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationFlt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody
-
Additional InformationThis is a rabbit polyclonal antibody against FLT3LG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
DescriptionFAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
-
French translationanticorps
-
Gene target
-
Short nameFlt3 Ligand antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal Flt3 Ligand antibody raised against the N terminal of FLT3LG
-
Alternative techniqueantibodies
-
Alternative to gene targetfms-related tyrosine kinase 3, CD135 and FLK-2 and FLK2 and STK1, FLT3 and IDBG-19891 and ENSG00000122025 and 2322, transferase activity, nuclei, Flt3 and IDBG-209045 and ENSMUSG00000042817 and 14255, BT.28173 and IDBG-630678 and ENSBTAG00000018572 and 512700
-
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data