Flt3 Ligand antibody

• Catalog number
  70R-7181
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cytokines & Growth Factors
• Type of Immunogen
  Flt3 Ligand antibodies were raised using the N terminal of FLT3LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY
• Raised in
  Rabbit
• Specificity
  Flt3 Ligand antibody was raised against the N terminal of FLT3LG
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLT3LG antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  Flt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody
• Additional Information
  This is a rabbit polyclonal antibody against FLT3LG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Description
  FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
• French translation
  anticorps

• Gene target
  Flt3   Ligand  
• Short name
  Flt3 Ligand antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal Flt3 Ligand antibody raised against the N terminal of FLT3LG
• Alternative technique
  antibodies
• Alternative to gene target
  fms-related tyrosine kinase 3, CD135 and FLK-2 and FLK2 and STK1, FLT3 and IDBG-19891 and ENSG00000122025 and 2322, transferase activity, nuclei, Flt3 and IDBG-209045 and ENSMUSG00000042817 and 14255, BT.28173 and IDBG-630678 and ENSBTAG00000018572 and 512700

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products