Filters
Technique
Supplier
Species
Label
Isotype
Host
E Coli or Yeast or Baculovirus or Mammalian Cell (3776692)
Rabbit (836747)
mouse (505233)
Rat (316811)
Yeast (249971)
e. coli (246119)
Mouse (144407)
Assay (129152)
Goat (116360)
Rabbit Oryctolagus cuniculus (63437)
Sheep (62029)
E Coli (55857)
mouse monoclonal (36035)
Horse (31963)
Hamster (29225)
Camel (24523)
coli (17786)
Synthetic (9542)
Source Human Homo sapiens (8815)
Host Rabbit Oryctolagus cuniculus (7923)
Human (6152)
N A (5464)
Mouse Mus musculus (5287)
Synthetic peptide (5131)
chemical synthesis (3294)
Chicken (3015)
Baculovirus (2131)
Sf9 (1753)
Donkey (1729)
Host Mouse (1648)
Baculovirus cells (1357)
HEK293 cells (1336)
Source Ascites (1297)
Host Mouse Mus musculus (1015)
Sf9 insect cells (1005)
Sf9 insect cells using baculovirus (957)
Host Mouse Source Ascites (919)
cho (866)
NA (818)
Host Goat (792)
CHO cells (750)
Escherichia Coli (745)
Guinea Pig (740)
Insect Cells (673)
Host Sheep (600)
293F cell (588)
Host Rabbit (573)
Host MouseSource Ascites (570)
HEK 293 cells (568)
Source Sheep serum (548)
Viral (524)
Recombinant (507)
Mouse Source Human (504)
Source Rabbit serum (503)
Source Mouse Mus musculus (502)
Rat Rattus norvegicus (501)
Human plasma (453)
Baculovirus Insect cells (436)
Mammalian cells (423)
Sf9 Insect Cells (418)
Human Plasma (413)
Sf9 Baculovirus Cells (398)
293 cell culture (384)
natural extract (330)
Host Rabbit Source Human (328)
CHO Cells (323)
Insect cells (320)
Protein conjugation (306)
recombinant (306)
Guinea pig (291)
Armenian Hamster (280)
HEk293 Cells (280)
MouseSource Human (278)
Bovine (270)
Pichia pastoris (265)
HEK293 Cells (248)
Source Zebrafish (231)
Baculovirus Sf9 insect cells (210)
Swine (195)
E ColiSource Human (193)
Baculovirus Cells (191)
Host Rabbit Source Rat (178)
Source Hybridoma cell culture (177)
Host RabbitSource Human (167)
HEK (163)
Mouse Balb c (143)
Coli (141)
HEK 293 cellsSource Human (138)
Source Mouse ascites (136)
Pichia Pastoris (131)
HEK 293 (128)
Semisynthetic (123)
Ag8 (121)
CHO (120)
E Coli derived (119)
Human 293 cell expressed (119)
Host Rabbit Source Mouse (117)
HEK293 (116)
Hybridization of P3X63 (113)
Baculovirus Insect Cells (112)
Mouse ascites (107)
Source Rat Rattus norvegicus (103)
rabbit (103)
Host Mouse Source Ascites Fluid (102)
Mouse Source Ascites (101)
HEK 293 cells Source Human (100)
Host Mouse Source Cell Culture (97)
Chinese Hamster Ovarian Cells CHO (94)
Dog (94)
Insect cell culture (91)
Host RabbitSource Rat (89)
Hybridization of P3X63 Ag8 (89)
Sf9 Insect cells (89)
Syrian Hamster (88)
Mouse Ascites (87)
Baculovirus infected Sf9 cells (86)
HEK 293 Cells (85)
Sf9 cells (82)
Recombinant E Coli (80)
Source Cell Culture (80)
MouseSource Ascites (79)
Streptomyces sp (79)
Rabbit Source Human (74)
Human E Coli (73)
Host Rat (72)
Nicotiana benthamiana (72)
Cat (64)
Pig (63)
Host RabbitSource Mouse (62)
Host MouseSource Cell Culture (61)
Multiple (61)
Mammalian Cell (60)
Bovine plasma (59)
Guinea (58)
Mouse MAB (58)
Prokaryotic expression (58)
Source Human (57)
Host MouseSource Ascites Fluid (56)
rat (56)
Placental villi (55)
Hi 5 Insect cells (54)
Murine (52)
Escherichia coli (50)
HEK293 cellsSource Human (49)
Insect Cell (48)
Human serum (46)
Insect Cell Expression System (46)
RabbitSource Human (46)
Saccharomyces cerevisiae (46)
Porcine (45)
HEK 293 cellsSource Mouse (44)
HEK Cells (44)
Normal mouse serum (44)
Mouse Source Cell Culture (43)
Human from E Coli (42)
Ascites (41)
BTI Tn 5B1 4 Hi 5 Insect cells (41)
High Quality Heparin (39)
Human Liver (37)
Human Patient (37)
Human Serum (37)
Human Urine (37)
Human myeloma plasma (37)
Source Rat ascites (37)
Human Donor (36)
Recombinant Human (36)
Llama (35)
Myeloma serum (35)
Host Mouse Source Culture (34)
Chinese Hamster Ovary Cells CHO (33)
Human heart tissue (33)
Hybridoma cell culture (33)
Myeloma Serum (33)
Canine (31)
Host Mouse Source Tissue Culture (31)
Source Tissue Culture (31)
Vero Cells (31)
Chicken Eggs (30)
Host Mouse Source Human (30)
Human Neutrophils (30)
Streptomyces avidinii (30)
Tissue culture supernatant (30)
Avian (29)
E ColiSource Mouse (29)
Normal rat serum (29)
Streptomyces Avidinii (29)
Human Neutrophil (28)
Mouse hybridoma (28)
RMab (28)
Sf9 Baculovirus (28)
Source Goat serum (28)
human E Coli (28)
Allantoic fluid of 10 day old embryonated eggs (27)
E coli (27)
Nicotiana benthamiana plant (27)
Recombinant Mouse (27)
cerevisiae (27)
Host MouseSource Tissue Culture (26)
Mouse plasma (26)
Source Porcine (26)
Cell Free Expression (25)
E Coli Source Human (25)
HeLa cells (25)
Human Heart (25)
MouseSource Cell Culture (25)
Pool of normal Syrian hamster sera (25)
Single Human Donor (25)
Baculovirus expression system (24)
Calf Thymus (24)
Host Mouse Source Tissue Culture Supernatant (24)
Human Myeloma Plasma (24)
Human Pituitary Glands (24)
Human liver (24)
Mammalian Cells (24)
Sf21 cells (24)
HIV I and HIV II antibodies (23)
Human Seminal Fluid (23)
Rat plasma (23)
293 Cell Culture (22)
Cell Culture (22)
Cultured in vitro (22)
Drosophia (22)
Rabbit Muscle (22)
Armenian hamster (21)
HEK293 Human Embryonic Kidney cell line (21)
Human Erythrocytes (21)
Human cells (21)
Human urine (21)
SF9 insect cells (21)
10 aqueous DMSO (20)
Host MouseSource Culture (20)
Native (20)
Porcine Heart (20)
Porcine Pancreas (20)
expressed in E Coli (20)
Chemical (19)
Host MouseSource Human (19)
Human Cardiac Tissue (19)
Human tissue (19)
Normal goat serum (19)
Pigeon (19)
Purified from chicken egg white (19)
Recombinant human (19)
Saccharomyces Cerevisiae (19)
Saccharomyces cerevisae (19)
Source Rat (19)
recombinant E Coli (19)
293F Cell (18)
Bacterial (18)
Equine (18)
Ethanolamine Salt (18)
Hi 5 cells (18)
Human Pancreas (18)
Human brain (18)
Purified from pooled normal mouse serum (18)
Turkey (18)
HF Cells (17)
Human Pregnancy Urine (17)
Human placenta (17)
Rabbit Mouse (17)
BaculovirusSource Human (16)
Bovine Serum (16)
Drosophila S2 (16)
Hamster Armenian (16)
Host Goat Source Human (16)
Host MouseSource Tissue Culture Supernatant (16)
Mouse IgG1 (16)
Purified from human urine (16)
Rb (16)
Recombinant Human E Coli (16)
Source Rabbit plasma (16)
293 Cell Line Human Embryonic Kidney (15)
Baculovirus in Sf9 insect cells (15)
Bovine Tissues (15)
Bovine tissues (15)
Calf Intestine (15)
Duck (15)
E Coli K5 bacterial culture (15)
Following ultracentrifugation (15)
HEK293 Human embryonic kidney cell line (15)
Host Human (15)
Human Pooled Serum (15)
Human Sera (15)
Human cell expressed (15)
Human seminal fluid (15)
Pooled Human Donors (15)
Pregnant Human Donor (15)
Purified from pooled normal human serum (15)
Rabbit serum (15)
Recombinant from E Coli (15)
Rice Grain Oryza Sativa (15)
Sheep serum (15)
Urine of post menopausal women (15)
from human plasma (15)
293 cells (14)
BHK cells (14)
BTI Tn 5B1 4 Hi 5 Insect Cells (14)
BaculovirusSource Mouse (14)
HEK cells (14)
HSV 1 MacIntyre Strain (14)
Host Chicken Source Rat (14)
Human 293 cells (14)
Human Pituitary Gland (14)
Human Platelets (14)
Mammalian Cell Expression System (14)
Peptide synthesis (14)
Sf9 CELLS INSECT (14)
Source Culture (14)
Cell culture (13)
Chinese hamster ovary CHO cells (13)
Human neutrophil (13)
Human recombinant protein expressed in E Coli (13)
Human skeletal muscle (13)
Insect cell (13)
Natural extract (13)
Normal rabbit serum (13)
Parasite (13)
Pooled normal human sera (13)
SF21 Insect cells (13)
Cloned from HBV 320 genome (12)
Feline (12)
HEK293E Cells (12)
Heparin from Porcine Mucosa (12)
Host Chicken Source Human (12)
Host E (12)
Human recombinant from E Coli (12)
Hybridization of P3 Ag8 (12)
Hybridization of Sp2 0 myeloma Source Ascites (12)
Hybridization of X63 (12)
Liver Carcinoma (12)
Mammalian Cell Line (12)
Pichia (12)
Purified From HEK 293 Cell culture Supernatant (12)
Purified from Bovine milk (12)
Purified from pooled normal goat serum (12)
Rabbit Reticulocytes (12)
Recombinant Human E coli (12)
Source Bovine (12)
Very Low Density Lipoprotein VLDL (12)
Yeast or Baculovirus or Mammalian Cell (12)
Zaire ebolavirus (12)
coliSource E Coli (12)
synthetic peptide (12)
Corn (11)
Goat Serum (11)
HEK 293 cellsSource Rabbit (11)
HEK 293 cellsSource Rat (11)
Host HumanSource E Coli (11)
Human Fluids (11)
Human pituitary glands (11)
Human pregnancy urine (11)
NHDF Cells Strain AD169 (11)
Ostrich (11)
Pastoris (11)
Pichia pastorisSource Human (11)
Purified from pooled normal Canine serum (11)
Purified from pooled normal guinea pig serum (11)
Rabbit plasma (11)
Allantoic Fluid (10)
Allantoic fluid (10)
Baculovirus Sf9 Cells (10)
Baculovirus infected Silkworm (10)
Bovine Thymus (10)
CHO Cell (10)
Cattle (10)
Egg white (10)
Goose (10)
Hi 5 Cells (10)
Host Mouse Source Cell Culture Supernatant (10)
Human Adenocarcinoma (10)
Human Adipose Tissue (10)
Human Blood (10)
Human Embryonic Kidney cells (10)
Human Milk (10)
Human Stomach (10)
Insect cell Baculovirus Source Mouse (10)
Mouse chimeric (10)
Mouse myeloma cell line (10)
Purified from Rabbit serum (10)
Quail (10)
Rice (10)
Rice Grain (10)
Source Mouse (10)
Tritirachium album (10)
insect cells (10)
653 myeloma cells (9)
Barley Endosperm Tissue (9)
Bovine Heart (9)
Bovine Kidney (9)
CHO cellsSource Human (9)
E ColiSource Yeast (9)
Hansenula polymorpha (9)
HeLa Cells (9)
Hi 5 cell (9)
Honey bee (9)
Host GoatSource Human (9)
Human Brain Tissue (9)
Human Cardiac Tissues (9)
Human Cord Serum (9)
Human Normolipidemic Plasma (9)
Human cDNA (9)
Human fluids (9)
Human heart (9)
Human metastatic liver carcinoma (9)
Human myeloma serum (9)
Human normolipidemic plasma (9)
IgG and IgA paraproteins (9)
Leishmania tarentolae (9)
Mammalian cell (9)
Murine E Coli (9)
NHDF Host Cell (9)
NS0 (9)
NSO cells (9)
New Zealand Rabbit (9)
Normal sheep serum (9)
Pooled normal human serum (9)
Purified from Arachis hypogaea seed (9)
Rabbit Thymus (9)
Recombinant E Coli strain (9)
S Cerevisiae (9)
Sf21 insect cells (9)
Strain P3HR1 (9)
Vero CellsStrain RH (9)
Yeast cells (9)
and human IgM (9)
recombinant from yeast cells (9)
Amycolatopsis sp (8)
BHK Cells (8)
Baculovirus system (8)
Bovine Brain (8)
CHO K1 (8)
CHO cellsSource Mouse (8)
Calf thymus (8)
Cell culture supernatant (8)
Chinese Hamster Ovarian Cells (8)
E ColiStrain AD169 (8)
Galanthus nivalis snowdrop bulb (8)
Genetically engineered Escherichia coli (8)
HEK 293 cellsSource Bundibugyo virus (8)
Host Chicken Source Opossum (8)
Host Horse (8)
Host Mouse Source Rat (8)
Host Rabbit Source Porcine (8)
Human B Cell (8)
Human cord serum (8)
Hybridization of Sp2 0 myelomaSource Ascites (8)
Hybridization of X63 Ag8 (8)
Isolated from human thyroid glands (8)
Mammalian Cell Expression System HEK293 (8)
McCoy (8)
Ms (8)
Penicillium sp (8)
Plasma (8)
Porcine pancreas (8)
Purified from S (8)
Rabbit Skeletal Muscle (8)
Rabbit Source Cell Culture (8)
Rat Liver (8)
Sacharomyces cerevisiae (8)
Source Canine (8)
Source Horse serum (8)
Source Human plasma (8)
Staphylococcus aureus (8)
Strain Ellen (8)
coli recombinant (8)
expressed in E (8)
strain LGVII 434 (8)
yeast recombinant (8)
Baculovirus infected High 5 cells (7)
Bovine Liver (7)
Bovine Pancreas (7)
Clostridium histolyticum (7)
Dog plasma (7)
Expressed in E Coli (7)
Goat serum (7)
Goat serum IgG digested with papain (7)
Host ChickenSource Human (7)
Host ChickenSource Rat (7)
Host Guinea pig (7)
Host MouseSource Cell Culture Supernatant (7)
Host RatSource Tissue Culture (7)
Human Cells (7)
Human Placenta (7)
Human Pleural Fluid (7)
Human Seminal Plasma (7)
Human Spleen (7)
Human erythrocytes red blood cells (7)
Hybridization of P3 X63 Ag8 (7)
Insect Sf9 Cells (7)
Male mouse submaxillary glands (7)
Monkey (7)
Mouse serum IgG digested with papain (7)
Pooled normal mouse sera (7)
Potato (7)
Rabbit serum IgG (7)
Rabbit thymus (7)
Rat recombinant protein expressed in E Coli (7)
Rat serum (7)
Rat serum IgG digested with papain (7)
Recombinant murine (7)
Source Guinea pig (7)
Source Rabbit Oryctolagus cuniculus (7)
Vero Host Cell (7)
cultured in vitro (7)
humanized antibody cultured in vitro (7)
1 myeloma cells with spleen cells from BALB c mice (6)
Allantoic fluid of 10 days old embryonated eggs (6)
Artiodactyla (6)
Bacteria (6)
Bovine pancreas (6)
CHO S Cells (6)
Chinese Hamster Ovary Cells (6)
Chinese Hamster Ovary cells (6)
Defibrinated Human Plasma (6)
E6 Host Cell (6)
E6 Virus strain MacIntyre (6)
Embryonated chicken eggs (6)
Food safety (6)
Fresh Human Plasma (6)
Genetically engineered E Coli (6)
Goat Country of Origin USA (6)
Goat IgG (6)
Green Algae (6)
HEK293T cells (6)
HSV 2 G Strain (6)
Hen egg white (6)
Horse serum (6)
Host Goat Source Rat (6)
Host Mouse Source Cell culture (6)
Host Rabbit Source E Coli (6)
Host Rabbit Source Opossum (6)
Host Sheeep (6)
Human 293 Cells (6)
Human CD33 Signal Peptide (6)
Human HDL (6)
Human Leukocytes (6)
Human Mouse chimeric (6)
Human Plasma HDL (6)
Human Red Blood Cells (6)
Human Saliva (6)
Human breast milk (6)
Human gastric mucosa (6)
Human normal serum (6)
Human placenta and blood (6)
Human synthetic peptide (6)
Hybridization of X63 Ag 8 (6)
Insect Cell Line (6)
MRC 5 Cells Strain AD169 (6)
Mammalian Cell Expression System CHO (6)
Mouse BALB c (6)
Mouse IgG2b (6)
Mouse Source Mouse (6)
Nasal Cartilage (6)
Normal chicken yolk (6)
Pichia pastoris co expressing NADPH Reductase (6)
Plasmin (6)
Porcine Mucosa (6)
Purified from Chicken serum (6)
Purified from Horse serum (6)
Purified from Human serum (6)
Purified from Pigeon Serum (6)
Purified from Rabbit plasma (6)
Purified from Sheep serum (6)
Purified from human milk (6)
Purified from pooled normal horse serum (6)
Purified from pooled normal porcine serum (6)
Purified from pooled normal rat serum (6)
Purified from pooled normal sheep serum (6)
Rat Erythrocytes (6)
Rat Plasma (6)
Recombinant protein from E Coli (6)
SF 9 Baculovirus (6)
Saccharomyces cerevisiae strain (6)
Salmon (6)
Source Chicken (6)
Source Equine (6)
Source Human Urine (6)
Source Tissue Culture Supernatant (6)
Strain producer of yeast Saccharomyces cerevisiae (6)
Streptomyces hygroscopicus (6)
Tissue Culture Sup (6)
Tissue culture (6)
VLDL (6)
Yeast Pichia pastor (6)
adw subtype (6)
anti HBc (6)
anti HCV (6)
containing plasmid pCGA7 (6)
fresh (6)
human (6)
non frozen (6)
Adult Male Rat Submandibular Glands (5)
Aeromonas Proteolytica (5)
Aeromonas proteolytica (5)
BHK cells Baby Hamster Kidney Cells (5)
Bacillus subtilis (5)
Baculovirus sf9 cells (5)
Baculovirus sytem (5)
Beauveria Nlyea (5)
Bovine Blood (5)
Bovine Hypothalamus (5)
Bovine Lens (5)
Bovine Milk (5)
Bovine Pituitary (5)
Bovine Spinal Cord (5)
Bovine Testis (5)
Bovine liver (5)
Bovine spinal cord (5)
Bovine vitreous humor (5)
CHO K1 Cells (5)
Calf Spleen (5)
Canine Serum (5)
Cell Culture Supernatant (5)
Chicken Gizzard (5)
Chicken gizzard (5)
Dog Heart (5)
Drosophila Schneider 2 S2 cells (5)
EBV (5)
Escherichia Cali (5)
Expressed in mammalian cell line (5)
Extracted from Pancreas (5)
Fetal calf serum FCS (5)
Goat Capra aegagrus hircus (5)
HCV (5)
HEK 293 cell line Human embryonic kidney (5)
HEK HumaXpress (5)
HEK Human embryonic kidney cells (5)
Hen s egg white (5)
Hi 5 (5)
Hi 5 Baculovirus (5)
Hi 5 Insect Cells (5)
Hi5 cells (5)
High Five insect cells (5)
Host Bovine (5)
Host Hamster (5)
Human Brain (5)
Human CNS (5)
Human Embryonic Kidney 293 Cells (5)
Human Embryonic Kidney 293 cells (5)
Human Embryonic Kidney HEK cells (5)
Human Erythrocyte (5)
Human Fluid (5)
Human Heart Tissue (5)
Human Myeloma Serum (5)
Human neutrophils (5)
Human pancreas (5)
Human urine from patients with tubular proteinuria (5)
Insects expression (5)
Kidney Bean (5)
MA104 Cells (5)
Mammalian cell expression system (5)
Mammalian system (5)
Mammals (5)
Mouse Submaxillary Gland (5)
Mouse serum (5)
Mushroom (5)
OPN Knockout Mouse (5)
Pepsin digest of normal goat IgG (5)
Pichia Pastoria (5)
Pig Liver (5)
Pooled human plasma (5)
Porcine Blood (5)
Purified from Human heart tissue (5)
Purified from Mouse Serum (5)
Purified from Rat serum (5)
Purified from Streptococcus hemolyticus (5)
Purified from chicken egg yolk (5)
Purified from the human plasma (5)
Rabbit IgG (5)
Recombinant Baculovirus (5)
Rice Flour (5)
Scorpion (5)
Spodoptera frugiperda (5)
Streptomyces avermitilis (5)
Submaxillary Gland (5)
Submaxillary Gland of Grown Mouse (5)
Synthesis (5)
Tarantula (5)
Urine of pregnant women (5)
Wheat Germ (5)
coli Full Length protein P04406 (5)
coli Full length protein O15392 (5)
coli Full length protein P07306 (5)
coli Ser32 Lys333 P15529 (5)
coli Ser381 Gly683 P02788 (5)
357 (4)
653 Source Ascites (4)
A293 cells (4)
American Hamster (4)
Ascites fluid (4)
BTI Tn 5B1 4 High 5 Insect cells (4)
BTI Tn 5B1 4 High 5 insect cells (4)
Bacillus anthracis (4)
Bacterium Streptomyces avidinii (4)
Bee venom (4)
Bipolaris leersia (4)
Bovine E Coli (4)
Bovine Red Blood cells (4)
Bovine eye lens (4)
Bovine kidney (4)
Bovine lung (4)
Bovine milk (4)
Bovine serum or plasma (4)
Bovine submaxillary gland (4)
CHO 3E7 Cells (4)
Candida albicans culture (4)
Canine Urine (4)
Cell Culture in CHO Cell Line (4)
Chicken egg white (4)
Chicken serum (4)
Chimeric (4)
Cinchona spp (4)
Clostridium difficile (4)
Corn Zea Mays (4)
Difficile Culture (4)
Difficile Toxoid from Culture (4)
Dog Serum (4)
E Coli ASI (4)
E Coli Accession Number NP_005558 (4)
E Coli Expression System (4)
E ColiSource Acidaminococcus fermentans (4)
E ColiSource Bacillus subtilis (4)
E ColiSource Geobacillus stearothermophilus (4)
E ColiSource HIV1 (4)
E ColiSource HIV2 (4)
E ColiSource HRV14 (4)
E ColiSource Japanese encephalitis Virus (4)
E ColiSource Norovirus GI (4)
E ColiSource West Nile virus (4)
E ColiSource Zika virus strain Mr 766 ZIKV (4)
Equine Serum (4)
Escherichia Colilambda lysogen NM 989 (4)
Expressed in an insect cell line (4)
Factor Va (4)
Fish (4)
Furze gorse seeds (4)
Grown in Vero Cells (4)
HEK 293 cells Met1 Glu 215 (4)
HEK 293 cells Source HIV 1 (4)
HEK 293 cells Source Influenza A virus (4)
HEK 293 cells Source Mouse (4)
HEK 293 cellsSource Cynomolgus (4)
HEK 293 cellsSource Rhesus macaque (4)
HEK 293 cellsSource Zaire ebolavirus (4)
HEK293 cells Cys 32 His 430 (4)
HEK293 cells Gin 45 Ser 833 (4)
HEK293 cells Thr 25 Met 231 (4)
HEK293 cells Val 26 Gln 205 (4)
HIV 1 HIV 2 by verifying (4)
Hamster E Coli (4)
Hansenula Polymorpha (4)
Hi 5 insect cells (4)
High 5 cells (4)
Horse plasma (4)
Host Armenian hamster (4)
Host Balb C Mouse (4)
Host C57BL6 Mouse (4)
Host CD 1 Mouse (4)
Host ChickenSource Opossum (4)
Host Confidential (4)
Host Donkey (4)
Host Human Neutrophil (4)
Host Mouse Source Mouse ascites (4)
Host MouseSource Rat (4)
Host Rabbit Source Drosophila (4)
Host RabbitSource Porcine (4)
Human B Cell Host (4)
Human B Cell Strain P3HR1 (4)
Human CHO cells (4)
Human Fibroblast Cells (4)
Human Metastatic Liver of colon Adenocarcinoma (4)
Human PlasmaSource Human (4)
Human cardiac tissue (4)
Human embryonic kidney cell line (4)
Human fluid (4)
Human humanized antibody (4)
Human mouse heterohybridoma (4)
Human peripheral blood T lymphocytes (4)
Human platelets (4)
Human serum IgG digested with papain (4)
Human serum or plasma (4)
Human whole cell culture (4)
Hybridization of P3 X63 (4)
Hybridization of P3x63 Ag8 (4)
Hybridization of Sp2 0 Ag14 myeloma cells (4)
Insect cellSource Mouse (4)
Jack Bean Canavalia ensiformis (4)
Legionella pneumophila culture (4)
Llama Lama glama (4)
MDCK cellsStrain B Hong Kong 5 72 (4)
Mammalian cell line (4)
Mouse IgG2a (4)
Mouse Purified from ascites (4)
Mouse Serum (4)
Mouse Source Artificial tag (4)
MouseSource E Coli (4)
NS0 cells (4)
Ovarian carcinoma cell line (4)
P3H3 Human Burkitt s Lymphoma cells (4)
Peanut (4)
Pertussis Culture (4)
Pichia pasroris (4)
Plasminogen (4)
Porcine Intestinal MucosaSource Porcine (4)
Porcine Liver (4)
Porcine heart (4)
Porcine kidney (4)
Porcine pituitaries (4)
Porcine plasma (4)
Prepared without using TCA (4)
Purified from Bovine Serum (4)
Purified from Bovine plasma (4)
Purified from E Coli recombinant (4)
Purified from Guinea Pig erythrocytes (4)
Purified from Human erythrocytes (4)
Purified from Human plasma (4)
Purified from Mouse erythrocytes (4)
Purified from Rabbit Serum (4)
Purified from bovine heart (4)
Purified from rabbit erythrocyte (4)
Purified from sheep serum (4)
Purified from spinach leaf (4)
Purified from whole goat anti sera (4)
Purified frome rat serum (4)
RAJI strain (4)
Rabbit Source Schistosoma japonicum (4)
Rabbit lung (4)
Rabbit muscle (4)
Rabbit or Sheep (4)
RabbitSource Cell Culture (4)
Rabbitt (4)
Rat E Coli (4)
Rat Heart Tissue (4)
Rat brain mRNA (4)
Rat pancreas (4)
Recombinant Human IL 8 E Coli (4)
Recombinant Human MCP E Coli (4)
Recombinant truncated HEV ORF2 (4)
SARS CoV 2 coronavirus (4)
Serratia marcescens gene (4)
Serum of pregnant mares (4)
Sf9 insect cells Baculovirus (4)
Shark cartilage (4)
Source Armenian Hamster serum (4)
Source Balb C Mouse serum (4)
Source Bovine serum (4)
Source C57BL6 Mouse serum (4)
Source CD1 Mouse serum (4)
Source Donkey serum (4)
Source Hamster serum (4)
Source Human Neutrophils (4)
Source Monkey (4)
Source Mouse ascites Clone Monoclonal (4)
Source Mouse serum (4)
Source Rat serum (4)
Soy Bean (4)
Soybean (4)
Staphylococcus epidermidis (4)
Strain FH (4)
Strain G (4)
Tritirachium album limber (4)
Two mouse hybridomas (4)
Unidentified fungus (4)
VERO Cells Strain G (4)
VR 586 (4)
Wisteria floribunda seeds (4)
coli 11 179 AA Q03135 (4)
coli AA 1 165 P0DN86 (4)
coli AA 1 166 P23528 (4)
coli AA 1 188 O95445 (4)
coli AA 1 188 P01116 (4)
coli AA 101 469 P03956 (4)
coli AA 121 220 P51654 (4)
coli AA 1288 1632 P26358 (4)
coli AA 21 124 Q14508 (4)
coli AA 21 132 P01222 (4)
coli AA 210 346 P14780 (4)
coli AA 28 127 P04114 (4)
coli AA 80 400 P08727 (4)
coli AA 807 1050 P00450 (4)
coli Recombinant (4)
expressed in Hansenula polymorpha (4)
genotype 3 (4)
goat (4)
recombinant from E Coli (4)
1 myeloma cells with spleen cells from Balb c mice (3)
120 amino acids (3)
15 (3)
288 302 peptide (3)
293 Cells (3)
4 Hydroxynonenal BSA (3)
653 (3)
653 myeloma cells with spleen cells of BALB c mice (3)
653Source Ascites (3)
8 myeloma cells with spleen cells from BALB c mice (3)
8 myeloma cells with spleen cells from Balb c mice (3)
A 72 Cells Virus Serotype 1 (3)
A 72 Cells Virus Serotype 2 (3)
A 72 cells Virus strain 1 71 (3)
A549 cell cultureStrain P (3)
Activated rat T helper cells (3)
Ag (3)
Armenian hamster normal serum (3)
Ascites Fluid (3)
Aspergillus fumigatus (3)
Aspergillus fumigatus culture (3)
Aspergillus ochraceus MST FP2005 (3)
Atropa and Datura spp (3)
BHK 21 Cells Virus Strain No (3)
Bacillus thurigiensis Bt (3)
Baculovirus in Sf9 cells (3)
Baculovirus infected Bombyx Mori (3)
Baculovirus infected Sf9 (3)
Baculovirus insect cells (3)
Bee (3)
Bee Venom (3)
Biotinylated (3)
Black mamba (3)
Bovine Bone (3)
Bovine Calmodulin (3)
Bovine Plasminogen (3)
Bovine RBC s (3)
Bovine brain (3)
Bovine gamma (3)
Bovine hypothalamus (3)
Bovine materials are of US origin (3)
Bovine nasal cartilage (3)
Bovine spleen thymus (3)
Bovine thymus of US origin (3)
Bozek (3)
Broth base mediumStrain FH (3)
Broth suspensionStrain PKo (3)
CHO Recombinant Mouse (3)
CMV Strain AD169 (3)
CRFK Cells Virus strain Cornell (3)
CRFK Cells Virus strain Petaluma (3)
CRFK Cells Virus strain WSU 79 1146 (3)
Cell Culture Proprietary Expression System (3)
Cell CultureSource CHO Cells (3)
Cell culture derived (3)
Chicken Plasmin (3)
Chicken plasminogen (3)
Chimera (3)
Chinese Hamster Ovary CHO cells (3)
Cone Snail (3)
Cord Serum (3)
Corn kernels (3)
Crab Shell (3)
Cultured in broth base medium (3)
Cyno monkey (3)
Cyno monkey serum (3)
Defibrinated human plasma (3)
Derivative (3)
Dirofilaria immits (3)
Dog serum (3)
Donkey IgG (3)
Donkey serum (3)
Drosophilla (3)
E Coli derived recombinant (3)
E Coli expression system (3)
E Coli full length aa1 313 (3)
E Coli lysate (3)
E ColiSource Rat (3)
E ColiSource Trichomonas vaginalis (3)
E ColiStrain C194 (3)
E ColiStrain Ellen (3)
E ColiStrain IIIB (3)
E6 Virus strain G (3)
E6 cells Strain New Guinea C (3)
E6 cells virus strain H 87 (3)
E6 cells virus strain H241 (3)
E6 cells virus strain Th Sman (3)
EGF1 52 (3)
Edmonston Strain (3)
Elderberry bark (3)
Embyonated eggs Virus strain B Jiangsu 10 03 (3)
ExpiCHO (3)
ExpiCHO S (3)
FC 3TG Cells (3)
FRhK Cells (3)
Freestyle 293 F cell (3)
Fresh Goat Plasma (3)
Fusarium sp (3)
Gastric biopsy (3)
Giant keyhole limpet (3)
Goat F ab 2 IgG (3)
Goat of United States origin (3)
Golden Syrian Hamster serum (3)
HEK 293 Cell Line (3)
HEK 293 cells Asp 23 Arg 227 (3)
HEK 293 cells lle 20 Glu 512 (3)
HEK 293 cellsSource Zika virus strain Mr 766 ZIKV (3)
HEK293 cells Asp 27 Leu 342 (3)
HSV 1 Strain MacIntyre (3)
HSV 2 Strain G (3)
Helicobacter pylori (3)
Hens (3)
Hep 2 Host Cell (3)
Hi 5 Insect cells BTI Tn 5B1 4 (3)
High Density Lipoprotein (3)
High Purity Hormone Derivative (3)
His tagged (3)
Horse American source (3)
Horse Serum (3)
Host Chicken Eggs (3)
Host GoatSource Rat (3)
Host Mouse ascites (3)
Host MouseSource Cell culture (3)
Host RabbitSource Drosophila (3)
Host RabbitSource E Coli (3)
Host RabbitSource Opossum (3)
Host RatSource Ascites (3)
Host Source CHO cells (3)
Human Ascites (3)
Human Ascites Fluid (3)
Human CD33 signal peptide (3)
Human Cell Culture (3)
Human Elastase (3)
Human Embryo Lung Cell CultureStrain Ellen (3)
Human Embryo Lung cell cultureStrain Ellen (3)
Human GST my GST M1 1 (3)
Human Gastric Mucosa (3)
Human IgE Myeloma Cell Line (3)
Human Mammary cell line MCF7 (3)
Human Metastatic Liver (3)
Human PLasma (3)
Human Pituitary glands (3)
Human Plasma LDL (3)
Human Plasmin (3)
Human Platelet (3)
Human Semen (3)
Human Serum Plasma (3)
Human Skeletal Muscle (3)
Human adenocarcinoma cell line supernatant (3)
Human cell culture supernatant (3)
Human colostrum (3)
Human eosinophil (3)
Human fetal cord serum (3)
Human milk (3)
Human myeloma (3)
Human plasma LDL (3)
Human pleural fluid (3)
Human recombinant (3)
Human recombinant kidney (3)
Human thyroid gland (3)
Human thyroid glands (3)
Hybridization of NS Ag (3)
Hybridization of NS Ag 4 (3)
Hybridization of NS1 Ag4 (3)
Hybridization of NS1 myeloma cell line (3)
Hybridization of NSO myeloma cell line (3)
Hybridization of P3Ag8 (3)
Hybridization of P3X63Ag8 (3)
Hybridization of Sp2 0 Ag 1 (3)
Hybridization of Sp2 0 myeloma (3)
Hybridization of X63 AG (3)
Hybridization of X63 Ag (3)
IgG1 Kappa (3)
IgG3 Kappa (3)
Immunodeficient murine ascites (3)
Infected Cell Lystate (3)
Insect SF21 cells baculovirus expression system (3)
Insect cell expression system (3)
Insect cells Baculovirus (3)
Isolated from human pituitary glands (3)
Jeryl Lynn strain (3)
L Cells Virus Strain Prototype p (3)
LLC Cells Strain Abney (3)
LLC MK2 Cells (3)
LLC MK2 host cell (3)
Lancefield s Group B strain (3)
Liver (3)
MA 104 cells (3)
MCF 7 Cell Supernatant (3)
MCF 7 cell supernatant (3)
MDCK Cells Virus Strain D008 (3)
MDCK Cells Virus strain D004 (3)
MRC 5 CellsStrain AD169 (3)
MRC 5 cells Strain Adenoid 6 (3)
MRC 5 cells Virus Strain Ellen (3)
MRC 5 cellsStrain Adenoid 6 (3)
MW 21kD (3)
MW 4759 (3)
Megathura crenulata (3)
Met1 Gln333 (3)
Mixture of 4 Human Myeloma Plasmas (3)
Monkey serum (3)
Mouse EHS Sarcoma (3)
Mouse IgG1 myeloma cells (3)
Mouse L cells Strain 434 (3)
Mouse Myeloma Ascites MOPC 21 cell line (3)
Mouse Plasmin (3)
Mouse submaxillary glands (3)
MouseSource Mouse (3)
Murine E coli (3)
Murine ascites (3)
Murine myeloma cell line (3)
Murine pancreas (3)
Murine submaxillary glands (3)
Mycobacterium bovis BCG (3)
Mycoplasma pneumoniae cultureStrain FH (3)
Mycoplasma pneumoniae strain FH (3)
NCTC 10119 (3)
NHDF Cells (3)
NIH 3T3 Cells Virus Strain FL (3)
NP_001665 (3)
NS0 derived (3)
NS0 derived human CD45 (3)
NSO (3)
NSO Recombinant (3)
Neat Ascites from Mouse (3)
Neisseria meningitidis (3)
Neutralized pI 6 (3)
Normal Bovine Serum (3)
Normal Dog Serum (3)
Normal Human Serum (3)
Normal Sheep Serum (3)
Normal Sheep serum (3)
Normal human IgA (3)
Normal human IgG (3)
Normal mouse IgG (3)
Oryza sativa rice (3)
P3HR 1 Cells (3)
PAI 1 from human plasma (3)
PSA Human seminal fluidACT Human plasma (3)
Partially purified IgG fraction of rabbit serum (3)
Pepsin digest of goat anti human IgA (3)
Pepsin digest of goat anti mouse Ig (3)
Pepsin digest of goat anti mouse IgM (3)
Pepsin digest of goat anti rat IgG (3)
Pepsin digest of normal rabbit IgG (3)
Pepsin digest of rabbit anti mouse IgG H L (3)
Pichia pastoris co expressing NADPH Reuctase (3)
Pig Swine (3)
Pool of normal Rhesus monkey serum (3)
Pooled Defibrinated Human Serum (3)
Pooled human colostrum (3)
Porcine Erythrocytes (3)
Porcine Gall Bladder (3)
Post mortal Human Brain (3)
Postmortem human brain (3)
Purified beta Actin from Human platelets cells (3)
Purified from E Coli (3)
Purified from IgG (3)
Purified from a recombinant source (3)
Purified from ascites (3)
Purified from equine liver (3)
Purified from wheat seed (3)
Purified frome Chicken Serum (3)
QNRLLIRAREDFGVE (3)
RH Strain in Glycine Buffer (3)
Rabbit Thymus from North American origin (3)
Rabbit Thymus of US origin (3)
Rabbit and bovine thymus of US origin (3)
Rabbit skeletal muscle (3)
Rat Serum (3)
Rat plasmin (3)
Rat plasminogen (3)
Recombinant Canine (3)
Recombinant Rat (3)
Recombinant bovine IL 4 (3)
Recombinant corresponding to aa1 181 of human ATF3 (3)
Recombinant expressed in E Coli (3)
Recombinant human LAG 3 produced in CHO cells (3)
Recombinant human STK10 (3)
Recombinant mouse (3)
Recombinant protein (3)
Recombinant protein E Coli (3)
Recombination (3)
Rhesus monkey (3)
Rhodamine (3)
Saccharomyces cereviae containing plasmid pCGA7 (3)
Salmon Testes (3)
Seminal fluid (3)
Septic Plasma (3)
Sf21 (3)
Sf21cells (3)
Sf9 cell (3)
Snake venom (3)
Source E (3)
Source E Coli (3)
Source Hamster (3)
Source Mouse plasma (3)
Source Normal Chicken Eggs (3)
Strain 385 99 New York (3)
Strain A Kiev 301 94 like Johannesburg 33 94 (3)
Strain B956 Uganda (3)
Strain Cocktail Blend (3)
Strain HPV77 (3)
Strain IIIB (3)
Strain LGV2 (3)
Strain Long (3)
Strain Texas 1 77 H3N2 (3)
Streptomyces fradiae (3)
Streptomyces spp (3)
Supernatant of thrombin activated platelets human (3)
Synthesized (3)
Synthetic human NPR B a (3)
Synthetic peptide MW 1740D (3)
Synthetic peptide human (3)
Synthetic product (3)
Syrian hamster plasma (3)
TWAR strain CWL 029 cultured in HL cells (3)
Vero CellsDengue Strain CH53489 (3)
Vero CellsDengue Strain TVP 360 (3)
Vero CellsDengue Strain West Pacific 74 (3)
Vero cell cultureStrain Edmonston (3)
Vero cell cultureStrain Schmitt (3)
Vero cells Strain Long (3)
Vero cells Virus strain C243 (3)
Vero cells Virus strain Greer (3)
Vero cells Virus strain VP1 (3)
Vero cellsStrain C243 (3)
Vero cellsStrain Greer (3)
Virus Strain HPV77 (3)
Virus strain A New Caledonia 20 99 H1N1 (3)
Vitronectin (3)
Whole tachyzoites (3)
Widespread in nature (3)
aa1 (3)
albicans (3)
aureus (3)
ayw subtype (3)
bacteria (3)
bovine (3)
cerevisae (3)
deglycosylated avidin purified from egg white (3)
donkey (3)
from plasma (3)
full length aa1 344 (3)
guinea pig (3)
human Sf21 cell (3)
human hepatocellular carcinoma (3)
inoculated with Adenovirus (3)
inoculated with Influenza A virus (3)
inoculated with Respiratory Syncytial virus (3)
kappa light chain (3)
mature nucleocapsid core protein (3)
mouse from E Coli (3)
native (3)
normal serum (3)
origin (3)
produced in Pichia pastoris (3)
purified (3)
pylori Strain 43504 (3)
pylori Strain 49503 (3)
pylori isolate (3)
rat from E Coli (3)
recombinant protein (3)
sequence 14AQMSEDNHLSNTVRSQNDNR33 (3)
strain Long (3)
strain SA 11 (3)
strain Tonsil 99 (3)
thaliana (3)
type 6 (3)
1 VLP (2)
1aa 187 (2)
2um (2)
42202 (2)
A 19120 (2)
A 72 Cells Infected with Strain 1 71 (2)
AFP cell line (2)
ATCC VR 586 (2)
ATTC strain 49503 (2)
AY 5312 (2)
Abalone (2)
Adult knee cartilage (2)
Aspergillus terreus (2)
BGMK cell cultureStrain Cornelis (2)
Bacillus globigii (2)
Bacillus polymyxa (2)
Bipolaris sp (2)
Bordetella pertussis (2)
Bovine Pituitary Gland (2)
Bovine Placental villi (2)
Bovine Plasma (2)
Bovine articular cartilage (2)
Bovine erythrocytes (2)
Bovine heart (2)
Bovine lens (2)
Bovine placenta (2)
Bovine placenta villi (2)
Bovine recombinant protein expressed in E Coli (2)
Bovine skin (2)
Bovine testes (2)
Broth Base Medium (2)
CAS 276 (2)
CDC CWL 029 (2)
CHO S cell line (2)
CHX 3101 (2)
CRFK Cells Infected with Petaluma Strain (2)
CRFK Cells Virus Strain Cornell (2)
CRFK cells infected with Cornell Strain (2)
CRFK cells infected with Strain Cornell (2)
Campylobacter jejuni culture 33291 (2)
Canine Pituitary Gland (2)
Canine Thyroid Gland (2)
Capsicum spp (2)
Caucasian Donor (2)
Cerevisiae (2)
Chaetomium sp (2)
Chick sternal cartilage (2)
Chicken plasma (2)
Chilobrachys jingzhao (2)
Chinese earth tiger tarantula (2)
Coli recombinant (2)
Corynebacterium Diphtheria Culture (2)
Crotalus adamanteus venom (2)
Cultured in vivo (2)
Cyno monkey plasma (2)
Dairy Products (2)
Drosophila (2)
E Coli BL21 (2)
E Coli RFL47 (2)
E ColiStrain Dumas (2)
E6 Cells Lederle (2)
E6 Cells Strain MR 766 (2)
E6 Vero cells infected with CDV Lederle strain (2)
Edmonston strain (2)
Egg White (2)
Emericella sp (2)
Erythrocyte lysates (2)
Escherichia coli 0157 H7 (2)
Eukaryotic expression 293 F cell (2)
Extract from normal rat eye retina (2)
FDA approved Plasma (2)
FI 6339 (2)
Feline Cat (2)
Feline Serum (2)
Ferritin (2)
Fusarium moniliforme (2)
GS 1278 (2)
Garden Pea (2)
Grown in FRhK 4 Cells (2)
Grown in Human Fibroblast Cells (2)
Grown in MA 104 Cells (2)
Gymnoascus reesii (2)
HDAC4 antibody was produced in a Rabbit (2)
HEK 293 Cell Culture (2)
HEK 293 cells Glu 19 Asn 250 (2)
HEK 293 cells Glu 25 Lys 418 (2)
HEK293 Cell (2)
HSV 1 gD produced in Pichia pastoris (2)
Hamster Syrian (2)
Hamster plasma (2)
Hela cell line (2)
Hen Egg White (2)
Hep 2 Cells (2)
Horse Gram (2)
Host BovineSource Bovine pancreas (2)
Host Chicken Source Mouse (2)
Host Chicken Source Normal Chicken Serum (2)
Host Goat Source Human apolipoprotein AII (2)
Host Goat Source Mouse (2)
Host Goat Source Rabbit (2)
Host HumanSource Human plasma (2)
Host Mouse Serum (2)
Host Mouse Source Bovine (2)
Host Mouse Source Porcine (2)
Host MouseSource Bovine (2)
Host Rabbit Source Bovine (2)
Host Rabbit Source Chicken (2)
Host Rat Source Ascites (2)
Host Rat Source Cell Culture (2)
Host Rat Source Mouse (2)
Host Rat Source Tissue Culture Supernatant (2)
Host Sheep Source Mouse (2)
Human 293 Cells HEK293 (2)
Human A431 cells (2)
Human Brain Hippocampus (2)
Human Cord Blood (2)
Human Erythrocytes Red Blood Cells (2)
Human Female Donor (2)
Human Heart tissue (2)
Human Liver Carcinoma (2)
Human Pleural Ascites Fluids (2)
Human Seminal Fluid and Human serum (2)
Human Thyroid Tissue (2)
Human Thyroid tissue Negative for HBsAg (2)
Human cell culture (2)
Human erythrocytes (2)
Human fibronectin (2)
Human neutrophil granulocytes Buffy Coat (2)
Human pleural fluids (2)
Human serum Negative for HBsAg (2)
Human serum plasma (2)
Hybridization of NS 1 myeloma (2)
Hybridization of Sp2 0 Ag 14 Source Ascites (2)
Hybridization of Sp2 0 Ag14 myeloma Source Ascites (2)
Hybridization of Sp2 0myeloma Source Ascites (2)
Hybridization of X ICR F1 myeloma Source Ascites (2)
ICI 194660 (2)
Insect cell lysate (2)
Isolated from Bacillus thurigiensis Bt spores (2)
Jimson Weed (2)
Lentil Seed (2)
M 141 (2)
MO 911 (2)
MRC 5 Cells (2)
MST FP245 (2)
Mammalian Cell expression System HEK293 (2)
Mammalian HEK293 Cells (2)
Measles virus (2)
Meat (2)
Mid brain (2)
Mouse BALB c IgG1k (2)
Mouse IgM (2)
Mouse NSO 1 cells (2)
Mouse Source Bacillus anthracis (2)
Mouse Source Cell Culture CHO Cells (2)
Mouse Source E Coli (2)
Mouse Source Rabbit (2)
Mouse ascites Monoclonal (2)
Mouse brain (2)
Mouse myeloma ascites TEPC 15 cell line (2)
MouseSource Artificial tag (2)
NDC 0082 4155 (2)
NSC 762 (2)
NSC 77120 (2)
Nasal cartilage (2)
Natrual (2)
Naturally (2)
Nature (2)
Normal Chicken Serum (2)
Normal Human Brain Tissue (2)
Normal bovine serum (2)
Normal monkey serum (2)
Normal rhesus monkey serum (2)
Others (2)
Ovine seminal vesicles (2)
Ovis aries Sheep (2)
Papain digest of goat anti human IgG (2)
Parvum Culture (2)
Penicillium brevicompactum (2)
Penicillium decumbens (2)
Phage Display System (2)
Phoresis Plasma (2)
Photinus pyralis (2)
Plant (2)
Pneumophila Culture (2)
Pooled Normal Human Serum (2)
Pooled human blood serum plasma (2)
Pooled human retroplacental blood (2)
Pooled human serum or plasma (2)
Pooled normal feline serum (2)
Pooled normal human plasma (2)
Porcine leukocytes (2)
Prepared from human plasma (2)
Prepared from human serum plasma (2)
Produced from human ascites (2)
Produced in E Coli (2)
Proprietary (2)
Pygeum africanum (2)
Pylori CultureStrain 43504 (2)
RP 13057 (2)
RP 5171 (2)
Rabbit Source E Coli (2)
RabbitSource Schistosoma japonicum (2)
Rat IgG2a (2)
Rat brain (2)
Rat lung (2)
Rauwolfia serpentina (2)
Recombinant E (2)
Recombinant human PEBP1 (2)
Rice Husks (2)
Rice Seed (2)
Ro 7 0207 (2)
S espinosus (2)
S facilities (2)
S variabilis (2)
SARS CoV 2 S1 (2)
SC 11800 (2)
SKF 104864A (2)
SKF 525A (2)
SM 7338 (2)
Sambucus nigra Elderberry bark (2)
Sf9 Cells (2)
Sheep plasma (2)
Source Ascites Host Mouse (2)
Source Cell culture (2)
Source Normal Mouse Serum (2)
Source Rat Serum (2)
Source Sheep (2)
Source Xenopus (2)
Staphylococcus aureus mecA (2)
Strain 33153 (2)
Strain LV8 (2)
Streptomyces conglobatus (2)
Streptomyces erythreus (2)
Streptomyces lincolnensis (2)
Streptomyces peucetius (2)
Streptomyces spectabilis (2)
Syrian Golden Hamster (2)
This tPA is expressed in DS2 cells (2)
Thrixopelma pruriens (2)
Tritirachium album limber gene (2)
U 10149 (2)
U 18409AE (2)
VR 24 (2)
VR 538 (2)
VR 846 (2)
Vero Cell Culture Strain Long Strain VR 26 (2)
Vero Cells Strain Edmonston (2)
Vero cell cultureStrain Adenoid 6 (2)
Vero cells (2)
Vero cells Strain 16681 (2)
Vero cellsStrain 16681 (2)
WIN 24540 (2)
Whole rabbit serum (2)
Widely distributed in higher plants (2)
Widespread in plants (2)
chicken (2)
coli PAI 1 (2)
cultured in Vero cells (2)
enteritidis culture (2)
followed by gel filtration (2)
from rat plasma (2)
fungi (2)
murine (2)
paratyphi A culture (2)
paratyphi B culture (2)
pastoris expression system (2)
sequence 385RAELNQSEEPEAGES399 (2)
typhi culture (2)
typhimurium culture (2)
using only domestic animal materials (2)
059 27 (1)
1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (1)
1 myeloma cells with spleen cell from Lewis rat (1)
100 Swiss Mouse (1)
1162 F (1)
1314 TH (1)
14 myeloma cells with spleen cells of BALB c mice (1)
1489 RB (1)
16842 (1)
199 212 peptide QEEGLHSIYSFDET (1)
2 5410 3A (1)
2 PAM (1)
2 um (1)
27 400 (1)
28 muM (1)
3 39 ELDRICGYGTARCRKK CRSQEYRIGRCP NTYACCLRK (1)
3 MS (1)
33006 (1)
33355 (1)
37231 (1)
38489 (1)
4 41 (1)
4 C 32 (1)
4 trihydroxyethyl ether (1)
400045 (1)
41071 (1)
41982 BP (1)
4MP (1)
5 ASA (1)
5058 (1)
5071 (1)
53 32C (1)
53858 (1)
6 DI t BUTYL 4 METHYLPHENOL (1)
6063 (1)
64716 (1)
653 myeloma with spleen cells of Balb c mice (1)
67314 (1)
68618 (1)
6S3 (1)
7 Cells (1)
8088 CB (1)
A 145 (1)
A 35957 (1)
A 4020 (1)
A 4166 (1)
A 5283 (1)
A 65006 (1)
A 73001 (1)
AA 2414 (1)
AA 673 (1)
ABC 12 3 (1)
ABOB (1)
ABT 335 (1)
AC 1198 (1)
AF 1160 (1)
AF 1890 (1)
AF 864 (1)
AG 1749 (1)
AG EE 623 ZW (1)
AGN 1135 (1)
AH 5158A (1)
AHR 3070C (1)
AHR 619 (1)
AHR 857 (1)
AL 1241 (1)
AL 4682 (1)
ALK3 BMPR1A antibody was produced in Mouse (1)
ALO 1401 02 (1)
AM 1155 (1)
AMRINONE (1)
AOC3 VAP 1 antibody was produced in Goat (1)
APM (1)
ASL 601 (1)
AT 4140 (1)
AT 877 (1)
AT2266 (1)
ATCC 42202 (1)
ATCC 43504 (1)
ATCC VR 185 (1)
ATCC VR 24 (1)
ATCC VR 28 (1)
ATCC VR 538 (1)
AW 105 843 (1)
AXL antibody was produced in Mouse (1)
AY 24234 (1)
AY 27255 (1)
AY 61123 (1)
AY 64043 (1)
AZL O 211089 (1)
AZT (1)
Abbott 22370 (1)
Abbott 44090 (1)
Abbott 50192 (1)
Abbott 64077 (1)
Abbott 84538 (1)
Acacia spp (1)
Acanthamoeba castellanii (1)
Acetobacter pasteurianus (1)
Acinetobacter lwoffi RFL21 (1)
Acinetobacter lwoffi RFL26 (1)
Acokanthera and Strophanthus spp (1)
Acremonium sp (1)
Actinomadura sp (1)
Actinoplanes spp (1)
Actinoplanes teichomyceticus (1)
Actrinomadura sp (1)
Adenovirus 41 (1)
Adenovirus Type 5 Hexon (1)
Adenovirus humano 1 (1)
Adult (1)
Aerobacter aerogenes (1)
Aesculus hippocastanum (1)
African American Human Donor (1)
Allantoic fluid of chicken eggs (1)
Allergan 211 (1)
Aloe (1)
Alpaca (1)
Ammi visnaga Lam (1)
Amni visnaga (1)
Amylase alpha (1)
Anise (1)
Antibiotic LL Z1640 2 (1)
Antibiotic LL Z1640 4 (1)
Antithrombin (1)
Apo CI is purified from delipidated VLDL (1)
Apo CIII is purified from delipidated VLDL (1)
Apolipoprotein A II was produced in Rabbit (1)
Artemisia annua (1)
Arthrobacter luteus (1)
Asian Donor (1)
Aspergillus Fumigatus (1)
Aspergillus candidus MST FP2029 (1)
Aspergillus niger (1)
Aspergillus oryzae (1)
Aspergillus orzyae (1)
Aspergillus versicolor (1)
Asplenium and Juglans spp (1)
Astra 1512 (1)
Avian pigment (1)
B 360 (1)
B 7 (1)
B31 strain (1)
BA 33112 (1)
BAQD 10 (1)
BAX 1400Z (1)
BAY 2353 (1)
BAY 39007 (1)
BAY 59 7939 (1)
BAY 9010 (1)
BAY H 4502 (1)
BC 105 (1)
BDH 1298 (1)
BGMK cells (1)
BI 1356 (1)
BIBR 1048 (1)
BIRG 0587 (1)
BL 139 (1)
BL 191 (1)
BL 4162a (1)
BM 15075 (1)
BM 210955 (1)
BMS 181158 (1)
BMS 186295 (1)
BMS 206584 01 (1)
BMS 354825 03 (1)
BMS 477118 (1)
BMY 27857 (1)
BMY 28142 (1)
BRL 1621 (1)
BRL 2064 (1)
BRL 2288 (1)
BRL 39123 (1)
BRL 42810 (1)
BRL 43694A (1)
BRL 4910A (1)
BS 572 (1)
BS 749 (1)
BTS 18322 (1)
BU (1)
BW 256 U 87 (1)
BW 33A (1)
BW 430C (1)
BW 57 322 (1)
BW 72U (1)
BW 759U (1)
BW A509U (1)
BY 1023 (1)
Ba 34276 (1)
Ba 41166 E (1)
BaCillus stearothermophilus RFL 1434 (1)
Bacillus amyloliquefaciens H (1)
Bacillus caldolyticus (1)
Bacillus centrosporus RFL1 (1)
Bacillus cereus (1)
Bacillus coagulans VS 29 022 (1)
Bacillus firmus Auk (1)
Bacillus firmus S8 336 (1)
Bacillus licheniformis (1)
Bacillus licheniformis and B subtilis (1)
Bacillus megaterium RFL1390 (1)
Bacillus megaterium RFL68 (1)
Bacillus polymyxa colistinus (1)
Bacillus pumilus RFL1102 (1)
Bacillus species N (1)
Bacillus species RFL119 (1)
Bacillus species RFL1265I (1)
Bacillus species RFL143 (1)
Bacillus species RJ3 212 (1)
Bacillus species d1 34 (1)
Bacillus sphaericus Jo 22 024 (1)
Bacillus sphaericus RFL1236 (1)
Bacillus sphaericus RFL1285 (1)
Bacillus sphaericus Tk 4 5 (1)
Bacillus stearothermophilus RFL1107 (1)
Bacillus stearothermophilus X (1)
Bacillus sterothermophilus RFL1407 (1)
Bacillus subtilis 15 (1)
Bacillus subtilis R (1)
Bacillus subtilis RFL120 (1)
Bacilus pumilus (1)
Bafilomycin D (1)
Barley (1)
Bartonella henselae (1)
Bartonella quintana (1)
Bay 5097 (1)
Bay 5360 (1)
Bay A 173 (1)
Bay E9736 (1)
Bay M1099 (1)
Bay Vi 9142 (1)
Bayer L 1359 (1)
Bear bile (1)
Berberis and Mahonia spp (1)
Bergenia spp (1)
Biotin conjugated chemically in vitro (1)
Bjerkandera adusta (1)
Borage Oil (1)
Bordetella holmesii (1)
Bordetella parapertussis (1)
Borrelia afzelii (1)
Borrelia burgdorferi (1)
Borrelia garinii (1)
Bovine Achilles Tendon (1)
Bovine Cardiac Myoglobin (1)
Bovine Chymotrypsin (1)
Bovine Hyaluronidase (1)
Bovine Myocardium (1)
Bovine Placenta (1)
Bovine and rabbit tissues (1)
Bovine blood (1)
Bovine bone (1)
Bovine colostrum (1)
Bovine lung membrane (1)
Bovine spleen (1)
Bovine sternal cartilage (1)
Bovine thymus (1)
Bovine thymus tissue (1)
Bovine tissue (1)
Bovine tissue thymus (1)
Breadfruit (1)
Brevibacterium oxydans Iti 12 052 (1)
Brucella abortus (1)
C 238 (1)
C 5 and D 1 ex Bacillus brevis (1)
CB 313 (1)
CB 337 (1)
CCI 18781 (1)
CCI 4725 (1)
CD 271 (1)
CD4 antibody was produced in Mouse (1)
CDH1 E Cadherin antibody was produced in Goat (1)
CDKN2A p16INK4a antibody was produced in a Rabbit (1)
CFTR antibody was produced in Rabbit (1)
CGA 72662 (1)
CGP 2175E (1)
CGP 32349 (1)
CH 3565 (1)
CHEMR23 CMKR1 antibody was produced in Rabbit (1)
CHO cell line (1)
CHO cells tPA (1)
CHO dhfr (1)
CHX 3311 (1)
CHX 3673 (1)
CI (1)
CI 1008 (1)
CI 23860 (1)
CI 366 (1)
CI 440 (1)
CI 473 (1)
CI 906 (1)
CI 919 (1)
CI 928 (1)
CI 945 (1)
CI 978 (1)
CJ 91B (1)
CL 12625 (1)
CL 227193 (1)
CL 232315 (1)
CL 297939 (1)
CL 301423 (1)
CL 399 (1)
CL 40881 (1)
CL 65366 (1)
CL 71563 (1)
CL 82204 (1)
CL 871 (1)
CL 983 (1)
CMT (1)
CN 10395 (1)
CN 27554 (1)
CN 35355 (1)
CO 1 (1)
CP 10188 (1)
CP 10423 16 (1)
CP 1044 J3 (1)
CP 12009 (1)
CP 12299 1 (1)
CP 12574 (1)
CP 14445 16 (1)
CP 15 639 2 (1)
CP 16171 (1)
CP 16533 1 (1)
CP 28720 (1)
CP 45899 (1)
CP 52640 2 (1)
CP 556S (1)
CP 88 (1)
CRFK Cells Virus Strain Cornell 780916 115 (1)
CS 443 (1)
CS 500 (1)
CS 600 (1)
CS 866 (1)
CSAG 144 (1)
CT 535 18 (1)
CV 11974 (1)
CV 4093 (1)
CVT 303 (1)
Cacodylate (1)
Calf spleen (1)
Campylobacter jejuni (1)
Campylobacter jejuni cultureATCC 33291 (1)
Candida albicans (1)
Candida auris (1)
Candida rugosa (1)
Canine Cardiac Myoglobin (1)
Canine heart (1)
Canine thyroid gland (1)
Capture Rabbit (1)
Carbonic anhydrase from bovine erythrocytes (1)
Cardiotonic Digitalis lanata (1)
Caseobacter polymorphus (1)
Cassia Rheum spp (1)
Cercosporamide (1)
Ceruloplasmin (1)
Chicken Egg White (1)
Chicken Intestine (1)
Chicken brain (1)
Chicken egg ovalbumin (1)
Chicken erythrocytes (1)
Chicken red blood cells (1)
Chlamydia trachomatis (1)
Chlamydophila pneumoniae (1)
Chlamydophila psittaci (1)
Cinchona bark (1)
Cinnamomum camphora (1)
Citrated Source Plasma Fresh (1)
Citromycetin (1)
Citrus aurantium (1)
Citrus oils (1)
Cl 583 (1)
Cladosporium cladosporioides (1)
Claviceps purpurea (1)
Clone H10 (1)
Coal tar (1)
Coccidioides immitis (1)
Comamonas acidovorans Lti 19 021 (1)
Common animal sterol (1)
Common in plant essential oils (1)
Compactin (1)
Complement C3 antibody was produced in Goat (1)
Consented human donors (1)
Corydalis cava and Papaver spp (1)
Corynebacterium species RFL6 (1)
Coumarouna odorata (1)
Coxiella burnetii (1)
Cryptococcus neoformans (1)
Cryptosporidium parvum (1)
Culture (1)
Cultured in Broth base medium (1)
Cyclosporin C from Trichoderma sp (1)
Cyclosporin D from Trichoderma sp (1)
Cyclosporin H from Trichoderma sp (1)
Cystatin C (1)
Cytidine 5 diphosphocholine (1)
Cytokeratin AE1 AE3 antibody was produced in Mouse (1)
Cytomegalovirus (1)
D 18506 (1)
D 2083 (1)
D 365 (1)
D 47 (1)
D 50 (1)
D 860 (1)
DETF (1)
DH 581 (1)
DJ 1550 (1)
DJN 608 (1)
DL 458 IT (1)
DMO (1)
DPN (1)
DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (1)
DR 3355 (1)
DTPA (1)
DU 21220 (1)
DU 23000 (1)
Dactylium dendroides (1)
Dalbergia volubilis (1)
Deinococcus radiophilus (1)
Deoxybrevianamide E (1)
Derivative of cholic acid (1)
Derivative of hydrastine 01501009 (1)
Detection Chicken (1)
Digitalis lanata (1)
Digitalis spp (1)
Digoxin BSA (1)
Dirofilaria immitis (1)
Dolichos biflorus Horse Gram (1)
Dowco 179 (1)
Drug Free Human Donors (1)
Duck serum (1)
E 955 (1)
E Coli BL21 DE3 (1)
E Coli CM 5199 (1)
E Coli MRE 600 cells (1)
E Coli derived recombinant protein (1)
E Coli infected with T4 phage (1)
E Coli or Yeast (1)
E Coli strain K12 (1)
EBV VCA cell line (1)
EE3 ME (1)
EHS Sarcoma (1)
EL 737 (1)
EL 857 (1)
EL 970 (1)
EMD 33512 (1)
EN 15304 (1)
EN 1639A (1)
EN 1733A (1)
ENA 713 (1)
ENT 14250 (1)
ENT 27165 (1)
ENT 27311 (1)
EU 1806 (1)
EX 4355 (1)
EXD (1)
EXP 126 (1)
Eggs (1)
Embryonated Chicken Eggs (1)
Embryonic chicken brain (1)
Engelbreth Holm Swarm mouse tumor (1)
Enniatin A (1)
Enniatin A1 (1)
Enniatin B (1)
Enniatin B1 (1)
Enterobacter amnigenus RFL1104 (1)
Enterobacter cloacae RFL136 (1)
Enterocin from Streptomyces sp (1)
Enterococcus faecalis (1)
Enterococcus faecium (1)
Eprinomectin from Semi synthetic (1)
Eucalyptus and Lavender Oils (1)
Eupatorium pauciflorum (1)
F 440 (1)
F11 FX1 Factor XI antibody was produced in Sheep (1)
FAT 75634 (1)
FB 5097 (1)
FC 1157a (1)
FK 482 (1)
FLC 1374 (1)
FOXA2 antibody was produced in Goat (1)
FPL 670 (1)
FRhK 4 Cells (1)
FUDR (1)
Factor XII knockout mouse (1)
Feline Urine (1)
Female Human Donor (1)
Fennel and Other plant oils (1)
Fibrinogen (1)
Fibrinogen from human plasma (1)
Firefly (1)
Fish Liver Oils (1)
Fish Oils (1)
Francisella tularensis (1)
Free PSA (1)
Fresh frozen plasma (1)
Fresh goat plasma (1)
Fruits of Sorbus and Crataegus spp (1)
Fungal (1)
Fungus Fusicoccum Amygdali (1)
Fusarium equiseti (1)
Fusarium spp (1)
Fusidium spp (1)
G 24480 (1)
G 30320 (1)
G 33182 (1)
G 34586 (1)
G 35020 (1)
G 4 (1)
G25766 (1)
GER 11 (1)
GF 196960 (1)
GOE 3450 (1)
GP 45840 (1)
GP 47680 (1)
GR 109714X (1)
GR 2 925 (1)
GR 38032 (1)
GR 43175 (1)
GS 2989 (1)
GT 31 104 (1)
Galanthus (1)
Gardnerella vaginalis (1)
Geldanamycin (1)
Giardia intestinalis (1)
Goat Fibronectin (1)
Golden Syrian hamster (1)
Gramicidin A 87 (1)
Greer strain (1)
Griffonia simlicifolia (1)
H 154 82 (1)
H 168 68 (1)
H 365 (1)
HA 1077 (1)
HB 419 (1)
HC 1528 (1)
HC 20511 (1)
HCV E1 expressed in E Coli (1)
HCV E2 expressed in E Coli (1)
HDPC (1)
HEK 293 EBNA Cell Line (1)
HHV 6 (1)
HHV 8 (1)
HMOX1 HO 1 antibody was produced in Rabbit (1)
HOE 095K (1)
HOE 296 (1)
HOE 498 (1)
HOE 760 (1)
HPEK 1 (1)
HSV (1)
HTF 919 (1)
HWA 486 (1)
Haemophilus ducreyi (1)
Haemophilus influenzae (1)
Haemophilus influenzae Rd (1)
HeLa Tachyzoites (1)
Helicobacter pylori culture (1)
Herpes simplex 1 (1)
Herpes simplex 2 (1)
Hoe 881V (1)
Hong Kong 5 72 (1)
Horse Equine (1)
Horseradish roots (1)
Host BovineSource Bovine cardiac tissue (1)
Host CanineSource Dog cardiac tissue (1)
Host Chicken (1)
Host ChickenSource Mouse (1)
Host ChickenSource Normal Chicken Serum (1)
Host Cyno monkeySource Cyno monkey serum (1)
Host Goat Source serum (1)
Host GoatSource Human apolipoprotein AII (1)
Host GoatSource Mouse (1)
Host GoatSource Rabbit (1)
Host HamsterSource Multiple (1)
Host Human Eosinophil (1)
Host Human Heart (1)
Host Human MyelomaSource Human Myeloma Plasma (1)
Host Human Pituitary (1)
Host Human PlasmaSource Pooled human plasma (1)
Host HumanSource Human adenocarcinoma (1)
Host HumanSource Multiple (1)
Host Mouse Serum Source Normal mouse serum (1)
Host MouseSource Multiple (1)
Host MouseSource Porcine (1)
Host PigSource Porcine gastric mucosa (1)
Host Porcine (1)
Host Porcine Stomach (1)
Host PorcineSource Pig cardiac tissue (1)
Host PorcineSource Porcine gastric mucosa (1)
Host RabbitSource Bovine (1)
Host RabbitSource Chicken (1)
Host Rat Rattus norvegicus (1)
Host RatSource Cell Culture (1)
Host RatSource Cell Culture Supernatant (1)
Host RatSource Mouse (1)
Host RatSource Tissue Culture Supernatant (1)
Host Rhesus monkey (1)
Host SheepSource Human (1)
Host SheepSource Mouse (1)
Host Species (1)
Host Syrian HamsterSource Tissue Culture (1)
HuCAL (1)
Human BTA cell line supernatant (1)
Human Brain tTssue (1)
Human C Reactive Protein (1)
Human CA19 9 Cancer Antigen (1)
Human Carcinoma A431 Cells (1)
Human D Dimer (1)
Human Donor Liver (1)
Human E (1)
Human Embryonic Kidney Cells (1)
Human Eosinophils (1)
Human Epididymis Cell Line Supernatant (1)
Human Eryhtrocytes (1)
Human Factor XI (1)
Human Ferritin from human liver (1)
Human Fibrin Degradation Product X (1)
Human Fibrinogen (1)
Human Homo sapiens (1)
Human Lung (1)
Human Myeloma (1)
Human Myeloma IgE from plasma (1)
Human Myeloma plasma (1)
Human Newborn Child (1)
Human Plasma from US donors (1)
Human adenocarcinoma (1)
Human adult knee cartilage (1)
Human albumin protein purified by HPLC (1)
Human ascites fluid from tumors (1)
Human bile (1)
Human blood (1)
Human cardiac muscle (1)
Human cardiac tissues (1)
Human cell line U251 (1)
Human donors (1)
Human eosinophils (1)
Human erythrocyte (1)
Human erythrocyte lysates (1)
Human foreskin keratinocytes (1)
Human hemoglobin (1)
Human liver metastasis of colon adenocarcinoma (1)
Human liver tissue (1)
Human lung (1)
Human metastatic liver (1)
Human ovarian carcinoma (1)
Human ovary tissue (1)
Human pancreatic tissue (1)
Human pancreatic tumor fluids (1)
Human plasma fresh frozen (1)
Human recombinant E Coli (1)
Human spleen (1)
Human spleen ferritin (1)
Human sputum (1)
Human sternal cartilage (1)
Human synthetic (1)
Human tPA (1)
Human thyroid (1)
Human tumor cells (1)
Humicola Fuscoatra (1)
Hybridization of J558Lmouse myeloma cells (1)
Hybridization of NOS myeloma cell line (1)
Hybridization of P3 63X Ag8 (1)
Hybridization of P3 X63 Ag 8 (1)
Hybridization of P3U1 myeloma Hamster lymphocytes (1)
Hybridization of P3X63 Ag 8 (1)
Hybridization of P3X63 AgS (1)
Hybridization of S194 5 (1)
Hybridization of Sp2 0 Ag 14Source Ascites (1)
Hybridization of Sp2 0 Ag14 myelomaSource Ascites (1)
Hybridization of Sp2 0myelomaSource Ascites (1)
Hybridization of Sp2 O Ag (1)
Hybridization of X ICR F1 myelomaSource Ascites (1)
Hybridization of rat Y3 Ag1 (1)
Hybridization ofP3X63 Ag8 (1)
IBMX (1)
IC 351 (1)
ICI 204636 (1)
ICI 28257 (1)
ICI 45520 (1)
ICI D1033 (1)
ICOS CD278 antibody was produced in Rabbit (1)
IL 10 antibody was produced in Rat (1)
IL23A IL 23 P19 antibody was produced in Rabbit (1)
ITGAL CD11a antibody was produced in Rabbit (1)
Inactivated (1)
Inactivated adenovirus type 11 (1)
Inactivated adenovirus type 5 (1)
Indanomycin from Streptomyces sp (1)
Induced DLD 1 Cells (1)
Induced RAW 264 (1)
Infected testicular rabbit tissue (1)
Insect cell Baculovirus Source CHIKV (1)
Insect cell culture tPA (1)
Insect cells E Coli (1)
Insect galls (1)
Insecticidal (1)
Irradiation of ergosterol (1)
Isolated from human fibroblasts (1)
JB 8181 (1)
Jack Beans Canavalis ensiformis (1)
Jackfruit (1)
K 4024 (1)
K 4274 (1)
K salt (1)
KIN 493 (1)
KT 611 (1)
KW 110 (1)
KWD 2019 (1)
Kallikrein (1)
Karenia brevis (1)
Klebsiella pneumoniae (1)
Ko 1173 (1)
Kribbella sp (1)
L 1 (1)
L 2214 (1)
L 5103 (1)
L 669455 (1)
L 67 (1)
L isomer spectrum (1)
LB 46 (1)
LL37 Cathelicidin antibody was produced in Rabbit (1)
LM 94 (1)
LS 121 (1)
LS 519 CL2 (1)
LU26 054 0 (1)
LY 139037 (1)
LY 139603 (1)
LY 156758 (1)
LY 177370 (1)
LY 237216 (1)
LY 248686 (1)
LYO 31537 (1)
Lactoferrin (1)
Lancefield s Group A strain (1)
Latrunculia Magnifica (1)
Lechevalieria sp (1)
Lederle (1)
Legionella pneumophila (1)
Leishmania chagasi (1)
Leishmania infantum (1)
Lens culinaris Lentil Seed (1)
Lens esculenta (1)
Lepidium sativum and other Cruciferae (1)
Leuconoctoc mesenteroides (1)
Leuconostoc mesenteroides (1)
Leukocytes from donor s blood (1)
Leukocytes of purulent human sputum (1)
Lima Bean (1)
Listeria monocytogenes (1)
Long strain (1)
Lupinus spp and other Leguminosae (1)
Lysobacter (1)
M B 15497 (1)
M B 693 (1)
M B 9302 (1)
M II (1)
M33 strain (1)
MBBT (1)
MCI 186 (1)
MDA modified human albumin protein (1)
MDCK Cells (1)
MDL 16455A (1)
MDL 458 (1)
MDL 507 (1)
MDL 71754 (1)
MJ 10061 (1)
MJ 1999 (1)
MJ 4309 1 (1)
MJF 12637 (1)
MJF 9325 (1)
MK 0431 (1)
MK 0462 (1)
MK 0966 (1)
MK 130 (1)
MK 208 (1)
MK 233 (1)
MK 240 (1)
MK 360 (1)
MK 366 (1)
MK 401 (1)
MK 476 (1)
MK 733 (1)
MK 906 (1)
MK 956 (1)
ML 236B (1)
MLH1 antibody was produced in Mouse (1)
MLN 518 (1)
MMab (1)
MOUSE (1)
MP 12 (1)
MPO Myeloperoxidase antibody was produced in Mouse (1)
MS 932 (1)
MST 117594 (1)
MST AS4274 (1)
MST AS4458 (1)
MST AS5338 (1)
MST AS5567 (1)
MST AS5763 (1)
MST AS5822 (1)
MST AS5883 (1)
MST FP1765 (1)
MST FP1889 (1)
MST FP2038 (1)
MST FP2115A (1)
Maackia amurensis MAA (1)
MacIntyre E6 (1)
Male Human Donor (1)
Mamalian feces (1)
Mamallian Male Hormone (1)
Mammalian Hormone (1)
Many plants (1)
Mare (1)
Marine Sponge Theonella Swinhoei (1)
Maus (1)
McN 485 (1)
McN A 28833 109 (1)
McN JR 8299 11 (1)
Meat extracts (1)
Mentha piperita and other Mentha spp (1)
Metabolite in muscle and urine (1)
Metastatic liver carcinoma (1)
Methylobacterium species Dd 5 732 (1)
Microcccus luteus (1)
Micrococcus luteus Ng 16 122 (1)
Micrococcus varians RFL1269 (1)
Micromonospora myoensis (1)
Micromonospora spp (1)
Milk (1)
Mixture of anthranol glycosides ex Cascara sagrada (1)
Monensin A from Streptomyces sp (1)
Monkey sternal cartilage (1)
Moraxella bovis (1)
Moraxella bovis Fr 1 022 (1)
Moraxella catarrhalis (1)
Moraxella phenylpyruvica RFL1103 (1)
Mou (1)
Mouse EHS sarcoma (1)
Mouse Fibrinogen (1)
Mouse Hybridization of NS 1 myeloma (1)
Mouse Plasma (1)
Mouse kidney (1)
Mouse myeloma ascites TEPC 183 cell line (1)
Mouse pancreas (1)
Mouse sternal cartilage (1)
Mouse submaxillary gland (1)
MouseSource Aequorea victoria (1)
MouseSource Bacillus anthracis (1)
MouseSource Cell Culture CHO Cells (1)
MouseSource Rabbit (1)
Mumps Enders (1)
Murine cells (1)
Mycelia sterilia fungus (1)
Mycobacterium avium (1)
Mycobacterium intracellulare (1)
Mycobacterium kansasii (1)
Mycobacterium tuberculosis (1)
Mycobacterium ulcerans (1)
Mycoplasma genitalium (1)
Mycoplasma hominis (1)
Mycoplasma pneumoniae (1)
N 714 (1)
NAD (1)
NAT 333 (1)
NC 150 (1)
NC 503 (1)
NCAM CD56 antibody was produced in Mouse (1)
NCS 406087 (1)
ND 50 (1)
NDR 5998A (1)
NE 58095 (1)
NF 180 (1)
NF 260 (1)
NFS 1776 (1)
NND 1962 (1)
NSC 10023 (1)
NSC 107680 (1)
NSC 109724 (1)
NSC 113926 (1)
NSC 123127 (1)
NSC 141046 (1)
NSC 157658 (1)
NSC 158567 (1)
NSC 2101 (1)
NSC 25855 (1)
NSC 26386 (1)
NSC 27640 (1)
NSC 312887 (1)
NSC 32065 (1)
NSC 3590 (1)
NSC 405124 (1)
NSC 49171 (1)
NSC 5085 (1)
NSC 56769 (1)
NSC 60584 (1)
NSC 60719 (1)
NSC 6091 (1)
NSC 63278 (1)
NSC 6396 (1)
NSC 64198 (1)
NSC 675 (1)
NSC 67574 (1)
NSC 746 (1)
NSC 763 (1)
NSC 77370 (1)
NSC 7778 (1)
NSC 78502 (1)
NSC 9120 (1)
NSC 92338 (1)
NSC 9565 (1)
NSC 9704 (1)
NSO Cells (1)
NY 198 (1)
Narcissus and other Lillaceae (1)
Native Protein S (1)
Native glutamic pyruvate transaminase (1)
Native inactivated mumps virus (1)
Neisseria denitrificans (1)
Neisseria gonorrhoeae (1)
Nematoloma frowardii (1)
Never Frozen (1)
New Zealand Rabbits (1)
Nicotiana tabacum (1)
Nocardia corallina (1)
Nocardiopsis sp (1)
Nonactin from Strepomyces griseus (1)
Normal Goat Serum (1)
Normal Monkey Serum (1)
Normal Pancreas (1)
Normal human plasma (1)
Novobiocin from Stretomyces sp (1)
Nso cells (1)
OPC 1085 (1)
OPC 13013 (1)
OPC 7251 (1)
ORG GB 94 (1)
ORG NC 45 (1)
Orientia tsutsugamushi (1)
Ovalbumin DNP (1)
Ovine (1)
Ovine Placenta (1)
Ovine placenta (1)
Oyster (1)
P 1011 (1)
P 12 (1)
P 3693A (1)
P3H3 (1)
P3HR1 cell line (1)
PAI 1 (1)
PAI 1 knockout mouse (1)
PARPBP C12orf48 antibody was produced in Rabbit (1)
PC 1 (1)
PD 107779 (1)
PH 5776 (1)
PLN Phospholamban antibody was produced in Goat (1)
PM 185184 (1)
PM 671 (1)
PMA Mouse Lymphoma Cell (1)
PN 200 110 (1)
PR 82 3 (1)
PS 2383 (1)
PTGER4 EP4 antibody was produced in Rabbit (1)
PTGS2 COX2 COX 2 antibody was produced in Rabbit (1)
Papaver somniferum (1)
Papaya latex (1)
Papillomavirus type 16 (1)
Papillomavirus type 18 (1)
Parvovirus B19 (1)
Peganium harmala seeds (1)
Penicillium griseofulvum (1)
Pentostatin from Streptomyces sp (1)
Pepsin digest of goat anti human IgM (1)
Pepsinized human placenta (1)
Pervanadate treated HepG2 cells (1)
Phaseolus vulgaris E4 lectin (1)
Physostigma venenosum (1)
Pichia yeast (1)
Pig Kidney (1)
Pig Pancreas (1)
Pig skeletal muscle (1)
Pinus spp (1)
Pizotifen (1)
Plant and animal tissue (1)
Platencin (1)
Platensimycin (1)
Pleurotus sp (1)
Podophylum peltatum (1)
Polygonum Hydropiper (1)
Polysaccharides in bacteria (1)
Pooled Female Donors (1)
Pooled Human Plasma (1)
Pooled defibrinated human serum (1)
Pooled human donor plasma (1)
Pooled normal bovine serum (1)
Pooled normal canine milk (1)
Pooled normal chicken serum (1)
Pooled normal chimpanzee milk (1)
Pooled normal chimpanzee serum (1)
Pooled normal equine milk (1)
Pooled normal human milk (1)
Pooled normal porcine milk (1)
Populus sieboldii (1)
Porcine Plasma (1)
Porcine Stomach (1)
Porcine Urine (1)
Porcine articular cartilage (1)
Porcine cardiac tissue (1)
Porcine gastric mucosa (1)
Porcine sternal cartilage (1)
Portulaca grandiflora (1)
Pregnacy urine (1)
Prepared from fresh human plasma (1)
Principal constituent of tree galls (1)
Proprietary Cell Line (1)
Proteus vulgaris (1)
Provided as a lyophilized salt free powder (1)
Providencia stuarti (1)
Provitamin A (1)
Pseudomonas aeruginosa (1)
Pseudomonas alcaligenes Sau14 027 (1)
Pseudomonas atlantica (1)
Pseudomonas diminuta Mck 33 321 (1)
Pseudomonas fluorescens (1)
Pseudomonas fragi mutant strain (1)
Pseudomonas syringae Lki1 pH124 (1)
Purified Bovine GFAP protein (1)
Purified Human Plasma (1)
Purified from Bovine serum (1)
Purified from Goat serum (1)
Purified from Human Plasma (1)
Purified from Rabbit skeletal muscle (1)
Purified from human serum (1)
Purified from pooled normal Porcine serum (1)
Purified from tissue culture supernatant (1)
Purified human liver carcinoma (1)
Purified human liver ferritin (1)
Purified myoglobin (1)
Purulent human sputum (1)
Pylori CultureStrain ATCC 43504 (1)
Quillaja bark (1)
R 12564 (1)
R 14950 (1)
R 1707 (1)
R 18553 (1)
R 23979 (1)
R 25788 (1)
R 33812 (1)
R 41400 (1)
R 42470 (1)
R 47465 (1)
R 51211 (1)
R 5147 (1)
R 516 (1)
R 51619 (1)
R 64433 (1)
R 64766 (1)
R 757 (1)
R 805 (1)
R 8299 (1)
R enatiomer of modafinil 01505361 (1)
R17889 (1)
R41468 (1)
RA 8 (1)
RAB54A RAB5 antibody was produced in Goat (1)
RAB7A RAB7 antibody was produced in Goat (1)
RC 27109 (1)
RC 61 91 (1)
RD 325 (1)
RET antibody was produced in Rabbit (1)
RG 83606 (1)
RH Strain Swiss mice (1)
RH Strain in PBS (1)
RH Strain mice (1)
RMI 9384A (1)
RMI 9918 (1)
RO 1 5130 (1)
RO 13 9297 (1)
RO 13 9904 (1)
RO 14 4767 (1)
RO 2 9915 (1)
RO 22 2296 (1)
RO 24 2027 (1)
RO 4 0403 (1)
RO 4 4393 (1)
RO 4 6467 (1)
RP 14539 (1)
RP 19583 (1)
RP 2275 (1)
RP 2632 (1)
RP 2786 (1)
RP 2921 (1)
RP 3276 (1)
RP 3277 (1)
RP 4753 (1)
RP 54780 (1)
RP 56976 (1)
RP 6140 (1)
RP 7162 (1)
RP 7452 (1)
RP 8595 (1)
RP 866 (1)
RP 8823 (1)
RP 9778 (1)
RS 079070 194 (1)
RS 21592 (1)
RS 35887 (1)
RS 3650 (1)
RS 43285 003 (1)
RS 69216 (1)
RS 8858 (1)
RSV Type A (1)
RU 2267 (1)
RU 23908 (1)
RU 28965 (1)
RU 38486 (1)
RU 486 (1)
RU 965 (1)
RWJ 17021 (1)
RWJ 25213 (1)
Rabbit Fibrinogen (1)
RabbitSource E Coli (1)
Rancid fats and Lycopodium spp (1)
Rat IgG2bk (1)
Rat Mouse (1)
Rat heart (1)
Rat kidney (1)
Rat liver (1)
Rat sternal cartilage (1)
Rat tendon excised from tail (1)
Recombinant Human RAP produced in E Coli (1)
Recombinant Phage Display (1)
Recombinant Pichia pastoris (1)
Recombinant protein encoding human (1)
Recombinant protein expressed in Sf21 cells (1)
Red Kidney Bean (1)
Red kidney bean (1)
Reombinant Human E Coli (1)
Retina (1)
Rheum palmatum (1)
Rickettsia conorii (1)
Ro 01 6794 706 (1)
Ro 12 0068 (1)
Ro 13 5057 (1)
Ro 13 8996 (1)
Ro 15 1788 000 (1)
Ro 18 0647 002 (1)
Ro 2 3773 (1)
Ro 2 9757 (1)
Ro 21 5998 (1)
Ro 21 9738 (1)
Ro 4 2130 (1)
Ro 4 3780 (1)
Ro4 4602 (1)
Root extracts of horseradish (1)
Roots of horseradish (1)
Rrv 144 (1)
Rubeola Edmonston strain (1)
Ruta Graveolens (1)
S 2539 F (1)
S 4532 (1)
S 9490 (1)
S 9780 (1)
SC 10363 (1)
SC 13957 (1)
SC 18862 (1)
SC 4642 (1)
SC 47111A (1)
SC 9376 (1)
SC 9420 (1)
SCH 10144 (1)
SCH 10649 (1)
SCH 13475 (1)
SCH 14714 (1)
SCH 20569 (1)
SCH 25298 (1)
SCH 4831 (1)
SD 17102 (1)
SDZ 212 713 (1)
SDZ ENA 713 (1)
SE 1702 (1)
SF 733 (1)
SF 86 327 (1)
SGD 301 76 (1)
SK F 14287 (1)
SK F 1995 (1)
SK F 51 (1)
SK F 6539 (1)
SK F 8542 (1)
SK F 96022 (1)
SK F D 75073 Z (1)
SKF 4657 (1)
SKF 62979 (1)
SKF 8898A (1)
SL 29 Host Cell (1)
SL 75212 10 (1)
SL 77499 (1)
SM 224 (1)
SN 13272 (1)
SN 390 (1)
SQ 1089 (1)
SQ 11725 (1)
SQ 13396 (1)
SQ 1489 (1)
SQ 16423 (1)
SQ 16603 (1)
SQ 18566 (1)
SQ 26776 (1)
SQ 6201 (1)
SQ 9453 (1)
SR 25990C (1)
SR 47436 (1)
SR 720 22 (1)
SR 96669 (1)
ST 813 (1)
STGSKQRSQNRSKTC C aa1 14 (1)
SU 101 (1)
SYNEPHRINE (1)
Saccharomyces porispora hiltus (1)
Salamander (1)
Salivary glands of Octopus vulgaris (1)
Salix spp (1)
Salmon Calcitonin (1)
Salmonella enteritidis (1)
Salmonella typhi (1)
Sambucus nigra (1)
Sanguinaria canadensis (1)
Sch 1000 (1)
Sch 15719W (1)
Sch 32088 (1)
Sch 6783 (1)
Sch 9724 (1)
Semi synthetic Moxidectin (1)
Sepharose Affinity Purification (1)
Serratia marcescens MST AS5330 (1)
Shigella flexneri (1)
Shrimph (1)
Silybum marianum (1)
Single Caucasian Donor (1)
Single Human Donors (1)
Snail Helix pomatia (1)
Snake Venom (1)
Source AscitesHost Mouse (1)
Source Duck (1)
Source Feline (1)
Source Human Cardiac Tissue (1)
Source Human Eosinophils (1)
Source Human Pituitary Glands (1)
Source Human Plasma (1)
Source Human plasma from multiple donors (1)
Source Human_x000D_ (1)
Source Mixed Bovine Spleen and Thymus (1)
Source Mollusk (1)
Source Mouse Ascites (1)
Source Mouse ascitesClone Monoclonal (1)
Source Pigeon (1)
Source Porcine Gastric Mucosa Stomach (1)
Source Rhesus monkey serum (1)
Soya (1)
St 1085 (1)
Staphylcoccus aureus strain V8 (1)
Stephania spp (1)
Steptomyces natalensis (1)
Strain 49503 (1)
Strain A New Caledonia 20 99 H1N1 (1)
Strain AD169 MRC 5 (1)
Strain ATCC 33153 (1)
Strain G produced in E6 cells (1)
Strain pHM 175 (1)
Streptococcus agalactiae (1)
Streptococcus faecalis NCTC6783 (1)
Streptococcus griseus (1)
Streptococcus milleri S (1)
Streptococcus pneumoniae (1)
Streptocyces avidinii (1)
Streptomyces Iysosuperficus (1)
Streptomyces Platensis (1)
Streptomyces albus (1)
Streptomyces ambofaciens (1)
Streptomyces aureofaciens (1)
Streptomyces aureofaiens (1)
Streptomyces aureus (1)
Streptomyces cinnamonensis (1)
Streptomyces griseolus (1)
Streptomyces griseus (1)
Streptomyces humidus (1)
Streptomyces kanamyceticus (1)
Streptomyces niveus and S griseus (1)
Streptomyces noursei (1)
Streptomyces orientalis (1)
Streptomyces pactum (1)
Streptomyces peucetius MST AS5775 (1)
Streptomyces ribosidificus (1)
Streptomyces rimosis paramomycinus (1)
Streptomyces rimosus (1)
Streptomyces staurosporeus (1)
Streptomyces tenebrarius (1)
Streptomycetes nodosus (1)
Strptomyces pilosus (1)
Strychnos nux vomica (1)
Strychnos spp (1)
Submaxillary glands (1)
Submaxillary glands of male mice (1)
Sweet Potato (1)
Synthetic B 15000 (1)
Synthetic PDK substrate peptide (1)
Synthetic human NPR C a (1)
Synthetic human beta Defensin 1 peptide a (1)
Synthetic human beta Defensin 2 peptide a (1)
Synthetic human beta Defensin 4 peptide a (1)
Syrian hamster (1)
T 1220 (1)
T 1824 (1)
T 3761 (1)
TACR3 NK3R antibody was produced in Rabbit (1)
TAK 375 (1)
TAK 491 (1)
TE 031 (1)
TEI 6720 (1)
TF Transferrin antibody was produced in Mouse (1)
TG2b murine myeloma cell line (1)
TGN46 TGN38 antibody was produced in Rabbit (1)
TH 1321 (1)
THQ (1)
THR (1)
TMX 67 (1)
TREM2 TREM 2 antibody was produced in Goat (1)
TTR Transthyretin antibody was produced in Goat (1)
Tea and cocoa constituent (1)
Teicoplanin Complex (1)
Telomycin (1)
Tetranactin from Streptomyces sp (1)
Texas Red Rabbit (1)
Th 22 (1)
The animals were free from infectious diseases (1)
Thermopsis lanceolata (1)
Thermus aquaticus Cc1 331 (1)
Thermus aquaticus YT 1 (1)
This protein is expressed in DS2 cells (1)
Thrombin (1)
Thyroid gland (1)
Tolypocladium inflatum (1)
Torpedo californica (1)
Toxoplasma gondii (1)
Transferrin (1)
Treponema pallidum (1)
Trichoderma sp (1)
Trichomonas vaginalis (1)
Tropaeolum majus (1)
Trypanosoma cruzi (1)
Trypanosoma rangeli (1)
Turkeys (1)
U 100766 (1)
U 101440 (1)
U 10858 (1)
U 17835 (1)
U 18573 (1)
U 2043 (1)
U 21251 (1)
U 26452 (1)
U 27182 (1)
U 36059 (1)
U 4527 (1)
U 6013 (1)
U 64279 (1)
U 8471 (1)
U 9889 (1)
UCB 1967 (1)
UCB 22059 (1)
UCB 6215 (1)
UCB L059 (1)
UCP2 antibody was produced in Goat (1)
UH AC 62XX (1)
UK 109496 (1)
UK 116044 04 (1)
UK 124114 (1)
UK 20349 (1)
UK 33274 27 (1)
UK 88525 04 (1)
UK 92480 10 (1)
UNII 5688UTCO1R (1)
UNII G2B4VE5GH8 (1)
UNII RNZ4305WW5 (1)
UP 83 (1)
UR 1521 (1)
Umbelliferae (1)
Uragoga ipecacuanha (1)
Ureaplasma urealyticum (1)
Urine and Blood (1)
VM 26 (1)
VP 16 213 (1)
VP1 Strain (1)
Various plants (1)
Vegetables (1)
Vero Cells Strain VP1 (1)
Vero CellsStrain VP1 (1)
Vero cell culture Strain (1)
Vero cell cultureStrain Conn (1)
Vero cell cultureStrain Faulkener (1)
Vero cell cultureStrain Long strain ATCC VR 26 (1)
Vibrio cholerae (1)
Vibrio species (1)
Vinca rosea (1)
Vincamine Vinca minor (1)
Virginiamycin Complex (1)
Virus BK (1)
Virus Epstein Barr (1)
Virus varicella zoster (1)
Vitamin A palmitate (1)
Vitamin B complex (1)
Vitamin B1 (1)
Vitamin C (1)
W 1655 (1)
W 3207B (1)
W 3566 (1)
W 4565 (1)
W 5219 (1)
W 8495 (1)
WIN 18320 (1)
WIN 40680 (1)
WIN 47203 2 (1)
WIN 5063 2 (1)
WR 142490 (1)
WY 21743 (1)
WY 3277 (1)
WY 44635 (1)
WY 45030 (1)
WY 45233 (1)
WY 5104 (1)
Water soluble derivative of chlorophyll (1)
Wheat germ (1)
Whole cell sonicate (1)
Widespread in animal tissue (1)
Widespread in animals (1)
Widespread in fungi and plants (1)
Widespread in living tissue (1)
Widespread in plants and animals (1)
Widespread in the plant and animal kingdoms (1)
Widespread in the plant and fungal kingdom (1)
Wy 1094 (1)
Wy 806 (1)
XU 62 320 (1)
XX0 (1)
Xanthobacter agilis Vs18 132 (1)
Xanthomonas ampelina Slo 51 021 (1)
Xanthomonas badrii (1)
Xanthomonas holcicola (1)
Xanthomonas maltophilia Jo 21 021 (1)
Xanthomonas maltophilia Jo 85 025 (1)
Xyris semifuscata (1)
YC 93 (1)
YM 67905 (1)
YM 905 (1)
YTR 830H (1)
Yersinia enterocolitica (1)
Z 4942 (1)
Z 6000 (1)
ZD 1033 (1)
ZD 1839 (1)
ZD 5077 (1)
ZK 30595 (1)
ZM 204639 (1)
Zanthoxylum avicennae (1)
Zoonosis (1)
alpha lipoic acid (1)
also Capsicum frutescens Cyperus spp (1)
also in Pisum sativum (1)
and HIV 1 and 2 antibodies (1)
animal protein (1)
ascites fluid from tumors (1)
bayk 5552 (1)
brain (1)
burgdorferi cultureStrain B31 Low Passage (1)
catechin (1)
cmpd 83405 (1)
coli Full length protein P0DN86 (1)
dates and Punica granatum seeds (1)
enantomer of lansoprazole 01503926 (1)
esp Quercus spp (1)
facilities (1)
from CHO cells (1)
from a crude lysate (1)
from human liver (1)
from human neutrophil (1)
from human saliva (1)
from human seminal fluid (1)
from human spleen (1)
from human urine (1)
from mouse plasma (1)
from porCine heart (1)
from porcine plasma (1)
fruits and grasses (1)
gamma Globulin (1)
gene denV in E Coli (1)
green plants and fungi (1)
griseus (1)
hepatotoxic (1)
higher plants (1)
host (1)
human heart (1)
invertebrates (1)
kidney (1)
lavender oil (1)
liver (1)
luzonensis (1)
many plants and animals (1)
mouse fibroblasts (1)
mp 94 deg C (1)
myeloma cells with spleen cells from Balb c mice (1)
negative for HbsAG (1)
normal brain (1)
other Penicillium spp (1)
p16INK4a antibody was produced in Mouse (1)
pastoris (1)
perfringens (1)
podophylotoxin (1)
polymyxin E (1)
purified by ultracentrifugation (1)
pylori culture (1)
pyrithioxin (1)
red kidney bean (1)
renal metabolite (1)
rutin 7 (1)
salbutamol (1)
single patient (1)
stable clone (1)
strain 1 (1)
striated muscle (1)
sugar beet (1)
synthetis (1)
then modified with tetranitromethane1 (1)
thioctic acid amide (1)
tonka beans (1)
vertebrates (1)
wheat germ and other plant oils (1)
whey and urine (1)
widely distributed in plants (1)
widespread in plants and animals (1)
with MIC90 of 0 (1)
yeasts (1)
Tissue
Virus
Disease
SKU
Product name
Supplier
Catalog no.
Size
Price
02014299650
CY7-PEG-NH2,2K
Info
Biochempeg
FL080005-2K
2 x 50mg
2159.75
Ask
03014300421
ACA-PEG-ACA,5K
Info
Biochempeg
HO010010-5K
2 x 5g
2313.18
Ask
02014300830
mPEG-Dansyl,2K
Info
Biochempeg
MF001046-2K
2 x 1g
702.08
Ask
01010801280
Neurokinin 1 Receptor Antibody
Info
Bioss Primary Unconjugated Antibodies
bs-0064R
0.1ml
423.89
Ask
01010162158
anti-CDH3 Antibody
Info
Bluegen antibodies
A01C0198
200ug (50ug, 100ug available)
749.46
Ask
01014301270
Goat Anti-Mouse IgG-Biotin
Info
Elabscience
SAEP030-100
100 μL
125.72
Ask
01014301189
miR Multi Assay kit Probe System I qPCR Master mix kit
Info
Heimbiotek
HMIP-S102-100
100 reactions
352.97
Ask
01014400279
ELISA kit for calcitonin gene related peptide,CGRP
Info
Icebergbiotech
EGP0003
1x96-well plate per kit
662.43
Ask
01014400728
ELISA kit for Interleukin-2 receptor,IL-2R
Info
Icebergbiotech
ES0009
1x96-well plate per kit
709.17
Ask
01014365623
ELISA kit for Metanephrine ,MN
Info
Icebergbiotech
ER0004
1x96-well plate per kit
662.43
Ask
01013807852
Total Protein Extraction Kit (for Animal Cultured Cells and Tissues)
Info
Inventbiotech
SN-002
1 kit/50 reactions
527.04
Ask
01012530159
Anti - C-erbB-2 (Her-2/neu) Antibody
Info
MBS Monoclonals
GEN684037
100ul Concentrate
659.21
Ask
01011439698
TNFAIP2 Antibody
Info
NJS poly
N1061-25UG
0.025mg
283.67
Ask
01010001638
Anti-Human ADAM-15
Info
Reliatech antibodies
101-M206
100ug
541.55
Ask
01013807903
Cell Culture Dish, 90x15mm, PS, sterile to SAL 10-6
Info
SPL
11090
10/500 sleeve/case
342.46
Ask
01014399673
Restriction endonuclease AsuNH I, 1000 u.a.
Info
Sibenzymes
E063-1000
1000 u.a.
169.23
Ask
01014296945
Anti-AB IgM, 1 viall of 10ml, 200 tests
Info
Tody laboratories
620010
10ml
59.63
Ask
01014297045
Apolipoprotein B
Info
Tody laboratories
C33SP1021-10
10 tests
103.15
Ask
01014588297
Foetal Bovine Serum Heat Inactivated - Premium Grade Qualified (125ml)
Info
TrinityTek
TT-01010301
125ml
183.74
Ask
01013613263
Porcine Foot-and-mouth disease Antibody ELISA kit
Info
Unibio
DES002
96-wells plate/kit
1982.45
Ask
01013613275
Mouse High specific of aflatoxin M1 monoclonal antibody
Info
Unibio
AT004
1000 µg
2756.09
Ask
01014298568
Recombinant baculovirus expressing Adrenergic Receptor alpha 1D
Info
Vector
GA11-1
1 mL
896.13
Ask
01014298201
Rapid Adenovirus Viditest
Info
Vidia tests
ODZ-285
1 cassette x 20 tests in kit
127.33
Ask
01012357215
Adar's Maleimide-Activated BSA
Info
adarbiot
1025-10
10 mg
628.58
Ask
01011989232
Recombinant Human ADAM15 Protein (His Tag)
Info
adv
RP-0023H
10μg
921.92
Ask
01011987922
pCHAC-hc-MYC Retrovirus Vector Validated
Info
allele
ABP-SC-VCREMYC
10µg
1555.02
Ask
01012078646
TFF2 Protein Lysate
Info
aviva
APL10193
one vial
426.50
Ask
01012054951
Protein A - HRP Conjugated
Info
aviva
OABB00873
one vial
736.57
Ask
01043746899
Human BDNF EasyTest™ ELISA kit
Info
bioaim scientific
1010003
96 tests
967.05
Ask
04012487525
11-Beta-Hydroxysteroid Dehydrogenase Type 1 (HSD11b1) Polyclonal Antibody
Info
bioma
CAU24477
200 μg
1208.81
Ask
01012614186
Calcineurin alpha Antibody ( CNA1)
Info
boster
MA1008
0,1 mg
515.76
Ask
02012221680
buffer solution in 50 ml. 4.00 pH
Info
consort
B004
100g
40.13
Ask
01012610615
Cysticercosis Antigen
Info
diagnostic africa
4650501
96-1 plate
285.28
Ask
01012222902
Hepatitis C Virus'S Total Antibody Detection - Elisa'S Testing Kit
Info
invitrotest
TK022
96 wells/plate
128.94
Ask
01011986799
anti-Human IgM (µ) -FITC (F(ab')2 Fragment) w/ counterstain - 3 ml
Info
virusys
AG041
1 item
209.53
Ask
01014298195
Biocidal ZF, 1 L
Info
wakchimie
WAK-ZF-1
1 L
167.62
Ask
01014588656
Mouse CD9 Human Monoclonal Antibody [VJ1/20]-PerCp
Info
Immunostep
BD-9PP-100T
100 TESTS
369.09
Ask
01014591453
Solution PI (Propidium Iodide)/RNAse
Info
Immunostep
PI/RNASE
200 TEST
151.50
Ask
01014421212
Goat anti-Mouse IgG (H&L)
Info
Aurion
100.022
1,5 ml
530.27
Ask
01024421488
Test-Tube Rack for STAT FAX 1904+ / 3300 / 4500
Info
Awarness Technology
AWAR-TK-10431
NA
32.24
Ask
01014421546
Chemwell-T Automated Chemistry Analyzer
Info
Awarness Technology
AWAR-TK-CWТ
1
11918.89
Ask
01013748645
SuperLumia ECL HRP Substrate Kit
Info
Abbkine
K22020-30
0.03 l
309.46
Ask
01012512476
5-Methoxytryptophan, Conjugated Antibody
Info
MBS Polyclonals
MBS615322
100ug
1487.65
Ask
01011969971
M-CSF Recombinant Protein
Info
proscience
40-620
0.01 mg
576.20
Ask
01011888090
anti-CCR3 Antibody
Info
proscience
1109
0.02 mg, 0.1 mg
290.12
Ask
02014407843
HbA1c ANALYZER BK-GLH01 Close system
Info
Biobase
BIO-BZ-1059
1 Unit
4672.46
Ask
01014423738
HiEncap Nutrient Broth
Info
Himedia
EC002CCL-2X75 No
2X75 No
244.99
Ask
01014423681
18 X 18 mm Microscope Cover Glass
Info
Himedia
BG011C-5X(10X100)
5X(10X100)
391.66
Ask
01014424516
DD007-1VL
Info
Himedia
DD007-100 X 1VL
Mannose -Mo-
393.27
Ask
01014424842
Dodeca UTI-II
Info
Himedia
DE005-50PK
50 PACKS
330.41
Ask
Filters
+32-(0)1-658-90-45
[email protected]
Sitemap
Contact
$
EUR
GBP
PLN
USD
Login or register
Total
products
: 13 041 068
Current
page
:
1
Go to first
|
Next
Compact list
Compact list
Extended list
Compact list
Compact list
Extended list
Sitemap
Contact
Currency: $
EUR
GBP
PLN
USD
Cart
Login or register
Contact us
Send
Close