Recombinant Mouse Usherin (Ush2A), partial

CAT: 0399-CSB-EP652408MO-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP652408MO-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

(Usher syndrome type IIa protein homolog) (Usher syndrome type-2A protein homolog)

Abbreviation

Recombinant Mouse Ush2A protein, partial

Gene Name

Ush2A

UniProt

Q2QI47

Expression Region

265-517aa

Organism

Mus musculus (Mouse)

Target Sequence

GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Involved in hearing and vision as member of the USH2 complex. In the inner ear, required for the maintenance of hair bundle ankle formation, which connects growing stereocilia in developing cochlear hair cells. In retina photoreceptors, the USH2 complex is required for the maintenance of periciliary membrane complex that seems to play a role in regulating intracellular protein transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.3 kDa

References & Citations

"Deletion of PDZD7 disrupts the Usher syndrome type 2 protein complex in cochlear hair cells and causes hearing loss in mice." Zou J., Zheng T., Ren C., Askew C., Liu X.P., Pan B., Holt J.R., Wang Y., Yang J. Hum. Mol. Genet. 23:2374-2390 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

UniProtKB · Q2QI47

Usherin

USH2A_MOUSE · Mus musculus

View on UniProt ↗

Primary accession: Q2QI47
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Ush2A
Protein existence: 1: Evidence at protein level
Organism: Mus musculus (Mouse)
Taxonomy ID: 10090
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: E9QLJ9, Q9JLP3

Protein keywords

Coding sequence diversity

Alternative splicing

Cellular component

Cell membraneCell projectionMembraneSecreted

PTM

Disulfide bondGlycoprotein

Biological process

HearingSensory transductionVision

Domain

Laminin EGF-like domainRepeatSignalTransmembraneTransmembrane helix

Technical term

Reference proteome

Related Products

Catalog	Name
CSB-EP7006MOV4-01	Recombinant Macaca fascicularis Usherin (USH2A), partial
CSB-EP022603MO-01	Recombinant Mouse Osteopontin (Spp1), partial
CSB-MP768917MO-01	Recombinant Mouse Tenascin (Tnc), partial
CSB-EP723362MO1-01	Recombinant Mouse Adiponectin (Adipoq), partial
CSB-EP005599MO-01	Recombinant Mouse Chymase (Cma1), partial
CSB-YP006554MO-01	Recombinant Mouse Decorin (Dcn), partial
CSB-EP015356MO-01	Recombinant Mouse Myocilin (Myoc), partial
CSB-EP022723MO-01	Recombinant Mouse Somatostatin (Sst), partial
CSB-EP017885MO1-01	Recombinant Mouse Prohibitin (Phb), partial
CSB-EP015741MO1-01	Recombinant Mouse Merlin (Nf2), partial

Alternative Products

Catalog	Name
MBS1382961-01	Recombinant Mouse Usherin (Ush2A) , partial
MBS1026243-01	Recombinant Human Usherin (USH2A) , partial
MBS1483179	Recombinant Rat Usherin (Ush2a) , partial
GTR19124412-01	Recombinant Macaca fascicularis Usherin (USH2A), partial
I1635	Usherin (USH2A) Mouse ELISA Kit
abx552714	Mouse Usherin (USH2A) ELISA Kit
MBS2905969-01	Mouse Ush2A / Usherin ELISA Kit
MBS9319794-01	Mouse Usherin, USH2A ELISA Kit
AE12060HU-01	Human Usherin (USH2A) ELISA Kit
MBS9390103-01	Monkey Usherin (USH2A) ELISA Kit