Recombinant Mouse Prohibitin (Phb), partial

CAT:
399-CSB-EP017885MO1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Prohibitin (Phb), partial - image 1

Recombinant Mouse Prohibitin (Phb), partial

  • Product Name Alternative :

    B-cell receptor-associated protein 32 (BAP 32)
  • Abbreviation :

    Recombinant Mouse Phb protein, partial
  • Gene Name :

    Phb
  • UniProt :

    P67778
  • Expression Region :

    1-40aa
  • Organism :

    Mus musculus (Mouse)
  • Target Sequence :

    MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD
  • Tag :

    N-terminal 6xHis-tagged
  • Type :

    Developed Protein
  • Source :

    E.coli
  • Field of Research :

    Cancer
  • Relevance :

    Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 85% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity) .
  • Molecular Weight :

    8.1 kDa
  • References & Citations :

    "Mammalian prohibitin proteins respond to mitochondrial stress and decrease during cellular senescence." Coates P.J., Nenutil R., McGregor A., Picksley S.M., Crouch D.H., Hall P.A., Wright E.G. Exp. Cell Res. 265:262-273 (2001)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Partial

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide