Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated

CAT:
399-CSB-MP773799HU-B-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated - image 1

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial, Biotinylated

  • Product Name Alternative:

    (B- and T-lymphocyte-associated protein) (CD antigen CD272)
  • Abbreviation:

    Recombinant Human BTLA protein, partial, Biotinylated
  • Gene Name:

    BTLA
  • UniProt:

    Q7Z6A9
  • Expression Region:

    31-150aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
  • Tag:

    C-terminal mFc-Avi-tagged
  • Type:

    Developed Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Relevance:

    Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    42.7 kDa
  • References & Citations:

    "T cell intrinsic heterodimeric complexes between HVEM and BTLA determine receptivity to the surrounding microenvironment." Cheung T.C., Oborne L.M., Steinberg M.W., Macauley M.G., Fukuyama S., Sanjo H., D'Souza C., Norris P.S., Pfeffer K., Murphy K.M., Kronenberg M., Spear P.G., Ware C.F. J. Immunol. 183:7286-7296 (2009)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial