Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active)

CAT:
399-CSB-MP773799HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active) - image 1
Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active) - image 2
Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active) - image 3
Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Human B- and T-lymphocyte attenuator (BTLA) , partial (Active)

  • Gene Name:

    BTLA
  • UniProt:

    Q7Z6A9
  • Expression Region:

    31-157aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRHHHHHHHHHH-
  • Tag:

    C-terminal 10xHis-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Cancer
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody (CSB-RA773799MAIHU). The EC50 is 11.56-13.00 ng/mL.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    16.1 kDa
  • References & Citations:

    "Point mutations in the BTLA gene in multiple myeloma and other hematologic malignancies." Mao Y., Wang X., Wu H., Chen Y., Ge Y., Chen J., Zhang X. Submitted to EMBL/GenBank/DDBJ databases (APR-2004) "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Gibbs R.A. Nature 440:1194-1198 (2006) "Complete sequencing and characterization of 21, 243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Partial
  • CAS Number:

    9000-83-3