Products for Research Use Only
RegisterLogin

Tryptophan Synthase, E.coli (His)

CAT: 0804-HY-P71098-01Size: 5 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71098-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. Tryptophan Synthase Protein, E.coli (His) is a recombinant protein dimer complex containing E. coli-derived Tryptophan Synthase protein, expressed by E. coli , with N-6*His labeled tag. Tryptophan Synthase Protein, E.coli (His), has molecular weight of 28 & 40-50 kDa, respectively.
Product Name Alternative
Tryptophan Synthase Protein, E.coli (His), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trpa-trpb-protein-e-coli-his.html
Purity
98.0
Smiles
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS&TTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI
Molecular Formula
946204&945768 (Gene_ID) P0A877 (M1-S268) &P0A879 (T2-I397) (Accession)
Molecular Weight
29&40-50 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71695-01SPEA, E.coli (His)
HY-P703062ColE7, E. coli (His)
HY-P702154-01BirA, E. coli (His)
HY-P701912HflC, E.coli (His)
HY-P71099TrpB, E.coli (His)
HY-P71704-01NrdD, E.coli (His)
HY-P76089-01SsPA, E. coli (His)
HY-P703455FimG, E.coli (His)
HY-P78944UDG, E.coli (His)
HY-P71528-01LUXS, E.coli (His)

Alternative Products

CatalogName
P519047Tryptophan Synthase Protein (N-His, E.coli)
PKSQ050057-01Recombinant E.coli Tryptophan Synthase Protein (His Tag)
MBS2557587-01Recombinant E Coli Tryptophan Synthase Protein (N-His)
32-8742-50Recombinant E. coli Tryptophan Synthase (N-6His)
CM30-500ugRecombinant E. coli Tryptophan Synthase α Chain/Trp A
32-8697-10Recombinant E. coli Tryptophan Synthase a Chain/Trp A
P519045Tryptophan Synthase α Chain; Trp A Protein (E.coli)
P519046Tryptophan Synthase β Chain; Trp B Protein (N-His, E.coli)
CM31-1mgRecombinant E. coli Tryptophan Synthase β Chain/Trp B
PKSQ050056-01Recombinant E.coli Tryptophan Synthase α Chain/Trp A Protein

Popular Products