Goat anti-Membrane Protein (SARS-CoV-2) Polyclonal antibody

• Description:

  Membrane protein (E) is one of the structural proteins of the virus. This glycoprotein that is the most abundant protein in the coronavirus envelope might act as a scaffold for the co-assembly of the complex of structural and accessory proteins that form the viral envelope.

• Specifications:

  In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.

• Product Name Alternative:

  ORF5, M SARS Coronavirus-2 antibody.

• Volume:

  100 µL

• Host:

  Goat

• Antigen Species:

  SARS-CoV-2

• Reactivity:

  Reacts with SARS-CoV-2 protein

• Immunogen:

  Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli.

• Target Antigen:

  Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli.

• Immunogen Type:

  Recombinant protein

• Target:

  anti-Membrane Protein (SARS-CoV-2)

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Conjugation:

  Unconjugated

• Type:

  Primary

• Sequence:

  LRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD

• Applications:

  WB

• Purification:

  Epitope affinity purified

• Concentration:

  3 mg/mL

• Dilution:

  WB:1:500-1:2,000

• Form:

  Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

• Buffer:

  PBS, 20% glycerol and 0.05% sodium azide

• Storage Conditions:

  For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

• CAS Number:

  9007-83-4