Goat anti-Membrane Protein (SARS-CoV-2) Polyclonal antibody

Goat anti-Membrane Protein (SARS-CoV-2) Polyclonal antibody

• Description: Membrane protein (E) is one of the structural proteins of the virus. This glycoprotein that is the most abundant protein in the coronavirus envelope might act as a scaffold for the co-assembly of the complex of structural and accessory proteins that form the viral envelope.
• Specifications: In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
• Product Name Alternative: ORF5, M SARS Coronavirus-2 antibody.
• CAS Number: 9007-83-4
• Volume: 100 µL
• Host: Goat
• Antigen Species: SARS-CoV-2
• Reactivity: Reacts with SARS-CoV-2 protein
• Immunogen: Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli.
• Target Antigen: Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: anti-Membrane Protein (SARS-CoV-2)
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: LRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD
• Applications: WB
• Purification: Epitope affinity purified
• Concentration: 3 mg/mL
• Dilution: WB:1:500-1:2,000
• Form: Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.