Goat anti-MERSC-CoV Spike Protein Polyclonal antibody

Goat anti-MERSC-CoV Spike Protein Polyclonal antibody

• Description: Goat polyclonal to Spike protein of Middle East respiratory Syndrome coronavirus. Coronaviruses access host cells by membrane fusion, a process mediated by specific fusion or “spike” proteins on the virion, often activated by cellular proteases.
• Specifications: Detects MERSC-CoV Spike (receptor binding domain) recombinant fusion proteins (MBP-S-protein and GFP-S-protein).
• Alternative Name: S-protein MERS-CoV antibody.
• Volume: 200 µL
• Host: Goat
• Antigen Species: Middle East Respiratory Syndrome coronavirus
• Reactivity: Middle East respiratory Syndrome coronavirus
• Immunogen: Purified recombinant peptide derived from within residues 381-505 aa (Spike receptor binding domain) of Spike protein from Middle East respiratory syndrome coronavirus produced in E. coli.
• Target Antigen: Purified recombinant peptide derived from within residues 381-505 aa (Spike receptor binding domain) of Spike protein from Middle East respiratory syndrome coronavirus produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: Anti-MERSC-CoV Spike Protein
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSR
• Applications: WB
• Purification: Epitope affinity purified
• Concentration: 3 mg/mL
• Dilution: WB:1:500-1:2,000
• Form: Polyclonal antibody supplied as a 200 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• References & Citations: 1. Cho H, Jang Y, Park KH, et al. NPJ Vaccines 2021 Mar. PMID: 33741992 2. Chun J, Cho Y, Park KH, et al. J Microbiol Biotechnol. 2019 May. PMID:30982320
• Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.