Goat anti-Spike RBD Domain (SARS-CoV-2) Polyclonal antibody

CAT:
894-AB0407-100
Size:
300 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-Spike RBD Domain (SARS-CoV-2) Polyclonal antibody - image 1

Goat anti-Spike RBD Domain (SARS-CoV-2) Polyclonal antibody

  • Description:

    The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.
  • Specifications:

    In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
  • Product Name Alternative:

    S glycoprotein SARS Coronavirus-2, Spike RBD Domain SARS Coronavirus-2 antibody.
  • Volume:

    100 µL
  • Host:

    Goat
  • Antigen Species:

    SARS-CoV-2
  • Reactivity:

    Reacts with SARS-CoV-2 protein
  • Immunogen:

    Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 343 to 400) and produced in E. coli.
  • Target Antigen:

    Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 343 to 400) and produced in E. coli.
  • Immunogen Type:

    Recombinant protein
  • Target:

    anti-Spike RBD Domain (SARS-CoV-2)
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Conjugation:

    Unconjugated
  • Type:

    Primary
  • Sequence:

    NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
  • Applications:

    WB
  • Purification:

    Epitope affinity purified
  • Concentration:

    3 mg/mL
  • Dilution:

    WB:1:500-1:2,000
  • Form:

    Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
  • Buffer:

    PBS, 20% glycerol and 0.05% sodium azide
  • Storage Conditions:

    For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
  • CAS Number:

    9007-83-4