Recombinant Rat Complement factor D (Cfd)

• Description :

  Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Cfd. Target Synonyms: Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D. Accession Number: P32038. Expression Region: 26~263aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• CAS Number :

  9000-83-3

• Short Description :

  Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein.

• Accession Number :

  P32038

• Expression Region :

  26~263aa

• Host :

  Yeast

• Target :

  Cfd

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 6Xhis-Tagged

• Field of Research :

  Immunology

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length of Mature Protein

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  27.8kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

• Species :

  Rat (Rattus norvegicus)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA