Recombinant Rat Complement factor D (Cfd)

CAT:
399-CSB-MP005271RA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Complement factor D (Cfd) - image 1

Recombinant Rat Complement factor D (Cfd)

  • Product Name Alternative :

    Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
  • Abbreviation :

    Recombinant Rat Cfd protein
  • Gene Name :

    Cfd
  • UniProt :

    P32038
  • Expression Region :

    26-263aa
  • Organism :

    Rattus norvegicus (Rat)
  • Target Sequence :

    ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
  • Tag :

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type :

    In Stock Protein
  • Source :

    Mammalian cell
  • Field of Research :

    Immunology
  • Relevance :

    Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 90% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
  • Molecular Weight :

    29.8 kDa
  • References & Citations :

    "Purification and partial characterization of rat factor D."Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779 (1991)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Full Length of Mature Protein

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide