STUB1, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


STUB1, Human
Description :
STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90) . STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.Product Name Alternative :
STUB1 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/stub1-protein-human.htmlPurity :
98.0Smiles :
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDYMolecular Formula :
10273 (Gene_ID) Q9UNE7 (M1-Y303) (Accession)Molecular Weight :
Approximately 33.0 kDaShipping Conditions :
Dry ice.Storage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

