Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2) , partial
CAT:
399-CSB-EP021581HU1-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2) , partial
- CAS Number: 9000-83-3
- Gene Name: SLC34A2
- UniProt: O95436-1
- Expression Region: 234-362aa
- Organism: Homo sapiens
- Target Sequence: VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
- Tag: C-terminal 6xHis-tagged
- Source: E.coli
- Field of Research: Signal Transduction
- Assay Type: Developed Protein
- Relevance: Involved in actively transporting phosphate into cells via Na+ cotransport.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 21.7 kDa
- References & Citations: New insights in the genetic variant spectrum of SLC34A2 in pulmonary alveolar microlithiasis; a systematic review. Jonsson A.L.M., Hilberg O., Simonsen U., Christensen J.H., Bendstrup E. Orphanet J Rare Dis 18:130-130 (2023)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.