Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

• Product Name Alternative:

  Na (+) -dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B

• Abbreviation:

  Recombinant Human SLC34A2 protein, partial

• Gene Name:

  SLC34A2

• UniProt:

  O95436

• Expression Region:

  574-689aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

• Tag:

  N-terminal 6xHis-B2M-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May be involved in actively transporting phosphate into cells via Na (+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

• Molecular Weight:

  27.1 kDa

• References & Citations:

  "Regulation of the human sodium-phosphate cotransporter NaPi-IIb gene promoter by epidermal growth factor." Xu H., Collins J.F., Bai L., Kiela P.R., Ghishan F.K. Am. J. Physiol. 280:C628-C636 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial