Products for Research Use Only
RegisterLogin

H2BC11, Human

CAT: 0804-HY-P72329Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72329Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
Product Name Alternative
H2BC11 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/h2bc11-protein-human.html
Smiles
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Molecular Formula
8970 (Gene_ID) P06899 (P2-K126) (Accession)
Molecular Weight
Approximately 13.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P703142H2BC4, Human
HY-RS05960H2BC12 Human Pre-designed siRNA Set A
HY-P71939-01Plasminogen, Human
HY-P705517S100A6, Human
HY-P704165PLD6 , Human
HY-P704148FABP3, Human
HY-P2995D-01Human Hemoglobin
HY-NP0233Human hemopexin
HY-P7257-01CCL4, Human
HY-P70593-01Fibronectin, Human

Alternative Products

CatalogName
TP311898H2BC11 (NM_021058) Human Recombinant Protein
GA105966Human H2BC11 activation kit by CRISPRa
GTR18950912H2BC11 Human Over-expression Lysate
LS008970-100ugH2BC11 (NM_021058) Human Over-expression Lysate
HP214020H2BC11 Human qPCR Primer Pair (NM_021058)
PH311898H2BC11 (NM_021058) Human Mass Spec Standard
QH27501SHuman H2BC11 qPCR Primer Pair
SC308826H2BC11 (NM_021058) Human Untagged Clone
RG211898H2BC11 (NM_021058) Human Tagged ORF Clone
SI006824AHuman H2BC11 Pre-designed siRNA Set A

Popular Products