CCL4, Human

• Description :

  CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli[1].

• Product Name Alternative :

  CCL4 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/mip-1-beta-ccl4-protein-human.html

• Purity :

  95.0

• Smiles :

  APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

• Molecular Formula :

  6351 (Gene_ID) P13236 (A24-N92) (Accession)

• Molecular Weight :

  Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]S G Irving, et al. Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q. Nucleic Acids Res. 1990 Jun 11;18 (11) :3261-70.|[2]Patricia Menten, et al. Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 2002 Dec;13 (6) :455-81.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins