ABCB5, Human (Trx)

CAT: 0804-HY-P7621Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7621Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

ABCB5, N-Trx Protein, Human is a plasma membrane-spanning protein that in humans is encoded by the ABCB5 gene. ABCB5 is an ABC transporter and P-glycoprotein family member principally expressed in physiological skin and human malignant melanoma[1].

Product Name Alternative

ABCB5 Protein, Human (Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/abcb5-n-trx-protein-human.html

Smiles

IRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFV

Molecular Formula

340273 (Gene_ID) Q2M3G0-4 (I586-V692) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

ABCB5αABCB5β

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P71041-01	ACAT2, Human (Trx-His)
HY-P72711	CD72, Human (Trx, His)
HY-P73633-01	SOCS3, Human (His-Trx)
HY-P702780-01	NR3C1, Human (His, Trx)
HY-P70932-01	HAO1, Human (Trx-His)
HY-P72140-01	CHRNA1, Human (His-Trx)
HY-P71223-01	PPIC, Human (Trx-His)
HY-P991180-01	TRX-518
HY-D1254-01	Trx-red
HY-160414-01	TRX-COBI

Alternative Products

Catalog	Name
TMPJ-01145-01	ABCB5 Protein, Human, Recombinant (Trx)
PEH0113-01	Recombinant Human ABCB5 (N-Trx)
P512947	ABCB5 Protein (N-Trx, Human)
KMH619-01	Recombinant Human ABCB5 Protein, Trx Tag
PR01004	Recombinant Human ABCB5 Protein, N-Trx
047220-01	ABCB5, Recombinant, Human, Trx-Tag discontinued
PKSH032096-01	Recombinant Human ABCB5 Protein (Trx Tag)
MBS8431112-01	Human ABCB5 Recombinant Protein N-Trx Tag Lyophilized
32-8243-50	Recombinant Human ATP-binding Cassette B5/ABCB5 (N-Trx)
IHUABCB5RNTRXLY50UG	Human ABCB5 Recombinant Protein N-Trx Tag Lyophilized 50UG

ABCB5, Human (Trx)

Related Products

Alternative Products

Popular Products