ABCB5, Human (Trx)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ABCB5, Human (Trx)
Description :
ABCB5, N-Trx Protein, Human is a plasma membrane-spanning protein that in humans is encoded by the ABCB5 gene. ABCB5 is an ABC transporter and P-glycoprotein family member principally expressed in physiological skin and human malignant melanoma[1].Product Name Alternative :
ABCB5 Protein, Human (Trx), Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/abcb5-n-trx-protein-human.htmlSmiles :
IRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFVMolecular Formula :
340273 (Gene_ID) Q2M3G0-4 (I586-V692) (Accession)Molecular Weight :
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
ABCB5αABCB5βShipping Conditions :
Room temperature in continental US; may vary elsewhere.Scientific Category :
Recombinant Proteins

