Products for Research Use Only
RegisterLogin

CD72, Human (Trx, His)

CAT: 0804-HY-P72711Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72711Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag.
Product Name Alternative
CD72 Protein, Human (Trx, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd72-protein-human-n-trx-6his.html
Smiles
RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Molecular Formula
971 (Gene_ID) P21854 (R117-C226) (Accession)
Molecular Weight
Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71041-01ACAT2, Human (Trx-His)
HY-P702780-01NR3C1, Human (His, Trx)
HY-P73633-01SOCS3, Human (His-Trx)
HY-P701254CD72, Human (HEK293, His)
HY-P70932-01HAO1, Human (Trx-His)
HY-P72140-01CHRNA1, Human (His-Trx)
HY-P71223-01PPIC, Human (Trx-His)
HY-P7986CD72, Mouse (His)
HY-P70970Serpin B6, Human (Trx-His)
HY-P7896A-01CD20/MS4A1, Human (Trx-His)

Alternative Products

CatalogName
TMPJ-00898-01CD72 Protein, Human, Recombinant (Trx & His)
YHD48302Recombinant Human CD72 Protein, N-Trx-His
E40KMP1480Recombinant Human CD72 Protein, Trx & His Tag
P514157CD72; Lyb-2 Protein (N-Trx-His, Human)
PKSH032112-01Recombinant Human CD72/Lyb-2 Protein (Trx&His)
CF13-01Recombinant Human CD72 (N-Trx-6His)
047232-01CD72/Lyb-2, Recombinant, Human, Trx-Tag, His-Tag discontinued
MBS8431594-01Human CD72 Recombinant Protein N-Trx, 6 His Tag Lyophilized
IHUCD72RNTRXHISLY10UGCD72 Recombinant Protein N-Trx & His Tag Lyophilized 10ug
Z04221-100CD72, His, Human

Popular Products