IL-1 alpha, Rat

CAT: 0804-HY-P72572-01Size: 10 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P72572-01Size:10 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][4]. IL-1 alpha protein, Rat is a recombinant protein consisting of 156 amino acids (S115-S270) and is produced by E. coli.
Product Name Alternative
IL-1 alpha Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-alpha-protein-rat.html
Purity
97.00
Smiles
SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
Molecular Formula
24493 (Gene_ID) P16598 (S115-S270) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Cavalli G, et al. Interleukin 1α: a comprehensive review on the role of IL-1α in the pathogenesis and treatment of autoimmune and inflammatory diseases. Autoimmun Rev. 2021 Mar;20 (3) :102763.|[2]Wu T, et al. Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A (2) in primary human bronchial epithelial cells. Cytokine. 2004 Jan 7;25 (1) :11-20.|[3]Um JY, et al. Functional polymorphism of IL-1 alpha and its potential role in obesity in humans and mice. PLoS One. 2011;6 (12) :e29524.|[4]Guo C, et al. IL-1α induces apoptosis and inhibits the osteoblast differentiation of MC3T3-E1 cells through the JNK and p38 MAPK pathways. Int J Mol Med. 2016 Jul;38 (1) :319-27.|[5]Malik A, et al. Function and regulation of IL-1α in inflammatory diseases and cancer. Immunol Rev. 2018 Jan;281 (1) :124-137.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P77001-01IL-22R alpha 1, Rat (HEK293, Fc)
HY-P77002-01IL-22R alpha 1, Rat (HEK293, His)
HY-P76417-01IL-13R alpha 1, Rat (HEK293, Fc)
HY-P79243-01IL-1 alpha/IL-1F1, Pig
HY-P7027-01IL-1 alpha, Human
HY-P7072-01IL-1 alpha, Mouse
HY-P73145-01IL-1 alpha, Human (HEK293)
HY-P81115-01IL-1 alpha Antibody (Rabbit)
HY-P70454GGMP IL-1 alpha, Human
HY-P71866-01IL-1 alpha, Rhesus macaque

Alternative Products

CatalogName
216648Interleukin 1 alpha (IL-1a, IL-1 alpha)
R20-024-L500IL-1 alpha

Popular Products