Products for Research Use Only
RegisterLogin

IL-1 alpha, Mouse

CAT: 0804-HY-P7072-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7072-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][2]. IL-1 alpha protein, Mouse is a recombinant protein consisting of 156 amino acids (S115-A270) and is produced by E. coli.
Product Name Alternative
IL-1 alpha Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-alpha-protein-mouse.html
Purity
99.0
Smiles
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Molecular Formula
16175 (Gene_ID) P01582 (S115-S270) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Cavalli G, et al. Interleukin 1α: a comprehensive review on the role of IL-1α in the pathogenesis and treatment of autoimmune and inflammatory diseases. Autoimmun Rev. 2021 Mar;20 (3) :102763.|[2]Wu T, et al. Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A (2) in primary human bronchial epithelial cells. Cytokine. 2004 Jan 7;25 (1) :11-20.|[3]Um JY, et al. Functional polymorphism of IL-1 alpha and its potential role in obesity in humans and mice. PLoS One. 2011;6 (12) :e29524.|[4]Guo C, et al. IL-1α induces apoptosis and inhibits the osteoblast differentiation of MC3T3-E1 cells through the JNK and p38 MAPK pathways. Int J Mol Med. 2016 Jul;38 (1) :319-27.|[5]Malik A, et al. Function and regulation of IL-1α in inflammatory diseases and cancer. Immunol Rev. 2018 Jan;281 (1) :124-137.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P83907-01IL-1 alpha Antibody (YA3604, Mouse)
HY-P85222IL-1 alpha Antibody (YA4914, Mouse)
HY-P79243-01IL-1 alpha/IL-1F1, Pig
HY-P7027-01IL-1 alpha, Human
HY-P72572-01IL-1 alpha, Rat
HY-P72547-01IL-36 alpha/IL-1F6, Mouse
HY-P77969-01IL-22R alpha 1, Mouse (HEK293, Fc)
HY-P78699-01IL-13R alpha 1, Mouse (HEK293, His)
HY-P70196-01IL-13R alpha 1, Mouse (HEK293, Fc)
HY-P70454GGMP IL-1 alpha, Human

Alternative Products

CatalogName
E34M001MIL-1 alpha, Mouse
MBS691985-01Mouse IL-1 alpha
RC444120Mouse IL 1 Alpha
OM296806-01IL 1 alpha Mouse
Z06181-500IL-1 alpha/IL-1A, His, Mouse
400-mL-005Recombinant Mouse IL-1 alpha/IL-1F1
RP00485Recombinant Mouse IL-1α/IL-1 alpha/IL-1F1 Protein
P1159-.1Recombinant Mouse IL-1 alpha
OM296798-01IL 1 alpha Mouse, His
GTR18906657-01Mouse IL-1 alpha protein

Popular Products