EEF1E1, Human (His)

• Description :

  The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.

• Product Name Alternative :

  EEF1E1 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/eef1e1-protein-human-his.html

• Purity :

  95.20

• Smiles :

  MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

• Molecular Formula :

  9521 (Gene_ID) O43324 (M1-H174) (Accession)

• Molecular Weight :

  Approximately 22 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins