CIB2, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CIB2, Human (His)
Description :
CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His) is the recombinant human-derived CIB2 protein, expressed by E. coli , with N-His labeled tag.Product Name Alternative :
CIB2 Protein, Human (His), Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/cib2-protein-human-his.htmlPurity :
96.0Smiles :
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRIMolecular Formula :
10518 (Gene_ID) O75838-1 (M1-I187) (Accession)Molecular Weight :
Approximately 26 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

