CRIPT, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CRIPT, Human (His)
Description :
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.Product Name Alternative :
CRIPT Protein, Human (His), Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/cript-protein-human-his.htmlPurity :
97.60Smiles :
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSVMolecular Formula :
9419 (Gene_ID) Q9P021 (M1-V101) (Accession)Molecular Weight :
Approximately 14 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

