RAB11A Antibody

• Description:

  Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

• Specifications:

  Western blot: 1-2 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence (FFPE) : 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P62491

• Host:

  Mouse

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.

• Clonality:

  Monoclonal

• Isotype:

  IgG2b

• Clone:

  4H9

• Applications:

  WB, IHC-P, IF, FACS

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the RAB11A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This RAB11A antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the RAB11A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the RAB11A antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, cell membrane

• Image Legend:

  IHC staining of FFPE human gastric carcinoma tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.